DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Hif1an

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001107221.1 Gene:Hif1an RGDID:1308281 Length:349 Species:Rattus norvegicus

Alignment Length:333 Identity:87/334 (26%)
Similarity:137/334 (41%) Gaps:84/334 (25%)


  Fly   107 ACSEILDEAQLLGCMEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDIPQLDAPSL 171
            |..|..:||:..|...|.|:|:                |...|| .|:.|::      |.| |..
  Rat    12 ASGEAREEAEAPGPAWDESQLR----------------SYSFPT-RPIPRLS------QSD-PRA 52

  Fly   172 EEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYA---SDEWSQQLV 233
            ||.    .|..:|.:|.:|...:||| || ||.||.:..||....:...|.:.   .||  :::.
  Rat    53 EEL----IENEEPVVLTDTNLVYPAL-KW-DLEYLQENIGNGDFSVYSASTHKFLYYDE--KKMA 109

  Fly   234 KIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPAL-----KEDISIPDYCTISNEDTPG---AV 290
            ..::|          |...|.|.:..||...::.|:     :|.:    |...:..||.|   .:
  Rat   110 NFQNF----------KPRSNREEIKFHEFVEKLQAIQQRGGEERL----YLQQTLNDTVGRKIVM 160

  Fly   291 DI--------------KAW---------LGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTD 332
            |.              :.|         :|..|.|:|.|||.:.|...|:.|.||.||..|...:
  Rat   161 DFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFE 225

  Fly   333 NLYPHDSEFLAN-TARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS---EAPS 393
            .|||:......: .:::|....|.|.:|....|..|:.::.|||.||:|..|||::.|   ...:
  Rat   226 CLYPYPVHHPCDRQSQVDFDNPDYERFPNFRNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGIT 290

  Fly   394 FSVSFWWE 401
            .:|:||::
  Rat   291 ITVNFWYK 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/267 (27%)
Hif1anNP_001107221.1 Cupin_8 53..297 CDD:290351 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.