DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Kdm8

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001032273.1 Gene:Kdm8 RGDID:1304823 Length:414 Species:Rattus norvegicus

Alignment Length:365 Identity:136/366 (37%)
Similarity:198/366 (54%) Gaps:41/366 (11%)


  Fly    59 ALVDRNWERIHTGHFSQVPLVTRKIYAIACCFKIFFLLLESTSPAQKDACSEIL---DEAQLLGC 120
            |::|.:||:::||.:..|....|::|:..|..|...|   ..:|.:..|.:|.|   |...|:|.
  Rat    67 AVLDYSWEKLNTGPWRDVDKEWRRVYSFGCLLKTLCL---CQAPQKATAVAEALRVCDMGLLMGA 128

  Fly   121 MEDWSELKVALMDYLDKDGAVALNSAPLPTL---------EPLTR-----------VTSNCDIPQ 165
                    ..|.|.|.| .|..|.:..||..         :|.|:           |..:.::|:
  Rat   129 --------AILGDILLK-VATVLQTHLLPRKQPACGPHQDQPATKKAKHDASSTPDVVLDREVPR 184

  Fly   166 LDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQ 230
            |..|.|:.|:......|:|.:|.....|||.:.|| .|.|:.::||.||||:|:||.|..::|||
  Rat   185 LRCPPLQHFKKHFLVPGRPVILEGVADHWPCMKKW-SLQYIQEIAGCRTVPVEVGSRYTDEDWSQ 248

  Fly   231 QLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKAW 295
            .|:.:.:|:.:....|....|    |||||:||.|||.||:||||||||.:.|.:.. .:.|.||
  Rat   249 TLMTVNEFIHKYILSEAKDVG----YLAQHQLFDQIPELKQDISIPDYCCLGNGEEE-EITINAW 308

  Fly   296 LGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPL 360
            .||.||:||:|.||:.|.|.||.|.|.|.|.:|.:::.:|||::..|.||:::|....|.|.:|.
  Rat   309 FGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQVDVENPDLEKFPK 373

  Fly   361 VAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 400
            ..:..|...:|.|||.|::|.|:||||||...||||||||
  Rat   374 FTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 102/230 (44%)
Kdm8NP_001032273.1 Interaction with RCCD1. {ECO:0000250|UniProtKB:Q8N371} 1..107 12/43 (28%)
Cupin_8 189..414 CDD:290351 103/232 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292019589
eggNOG 1 0.900 E1_KOG2132
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 245 1.000 Inparanoid score I3152
OMA 1 1.010
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 1 1.000 FOG0006582
OrthoInspector 1 1.000 T1088933
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.