DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Tyw5

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001163944.1 Gene:Tyw5 RGDID:1311269 Length:315 Species:Rattus norvegicus

Alignment Length:259 Identity:74/260 (28%)
Similarity:113/260 (43%) Gaps:57/260 (22%)


  Fly   163 IPQLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIE--------- 218
            :|:|...|.|:|....:...:| |:|..:.......|| .::||.||.|.:.|.|.         
  Rat     8 VPRLRGVSREQFMEHLYPQRKP-LVLEGLDLGSCTSKW-TVDYLSQVGGTKEVKIHVAAVAQMDF 70

  Fly   219 IGSNY-------------ASDEWSQQLVKIRD--FLSRQFGKEPSKAGQNIEYLAQHELFAQIPA 268
            |..|:             |::|..::....:|  :..|..|::|.|   :|..:.|     |.|:
  Rat    71 ISKNFVYRTLPFNKLVQRAAEETHKEFFISQDERYYLRSLGEDPRK---DIADIRQ-----QFPS 127

  Fly   269 LKEDISIP-------DYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILA 326
            |.|||:.|       .:.::....:||   ::.|         .|||...|.|.||.|.|||.|.
  Rat   128 LGEDITFPMFFREEQFFSSVFRISSPG---LQLW---------THYDVMDNFLIQVTGKKRITLF 180

  Fly   327 APADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSE 390
            :|.|...||...|:  :....||:..||  .|||..|.:.|:..|:.||.|::|..|:|.|.||
  Rat   181 SPRDAQYLYLSGSK--SEVLNIDSPDLD--KYPLFPKARRYECSLEAGDVLFIPALWFHNVVSE 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/251 (28%)
Tyw5NP_001163944.1 Cupin_8 17..264 CDD:290351 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.