DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and jmjd-5

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_505831.1 Gene:jmjd-5 WormBaseID:WBGene00007387 Length:578 Species:Caenorhabditis elegans

Alignment Length:434 Identity:124/435 (29%)
Similarity:211/435 (49%) Gaps:73/435 (17%)


  Fly     5 FLELTQLLPRW------VDLENVVRGEVEARYILKRAADHLANLRSGGDSGAEETGYLVGALVDR 63
            |.:..:.|..|      :.|::.|..:: .|.:..|.:.::.:..:|....::|       :||:
 Worm   181 FKQRLEDLDTWNFGILQIHLDDQVVSKL-IRNLFSRFSTNVDHFLNGNTEFSKE-------IVDQ 237

  Fly    64 NW-------ERIHTGHFSQVPLVTRKIYAIACCFKIFFLLLE-----STSPAQKDACSEILDE-- 114
            :.       .:::||||::|....||:|::.|..:.|.:..:     :...|.|..|...:||  
 Worm   238 SEFLLKLADTKLNTGHFNEVDENWRKLYSLICFCQSFMMFKQNKYEIAIKIADKGLCMGRIDEDL 302

  Fly   115 ---AQLLGCM---------EDWSELKVALMDYLDKDGAVALNSA-PLPTLEPLTRVTSNCDIPQL 166
               .||...:         :||..            .:...|:. ..|.|.||:...|..:..:.
 Worm   303 VPIRQLAWLIHENLPGVSSDDWIH------------SSFQFNTTNTYPALIPLSNSKSIDECDED 355

  Fly   167 DAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQ 231
            |..|.|:. ....:...|.::.....:.||:.|| ...:|||...:||.|:|||:.|:.:.|||:
 Worm   356 DENSFEKL-ISAVQNNTPLIVRRHSSNMPAIEKW-SFPFLLQELHSRTFPVEIGTKYSDENWSQK 418

  Fly   232 LVKIRDFLSRQFGKEPSKAGQNIE----YLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDI 292
            |:..::|:            :|.|    |||||.||.|:|.||.|:.|||.| ......|..||:
 Worm   419 LMTFKEFI------------RNSENERLYLAQHRLFDQVPHLKRDVIIPDVC-FGESSNPENVDM 470

  Fly   293 KAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPET 357
            ..|:||..||||:|.||:.|:..||.|:|...:.||..::::||.|. .|:||:::|....|.:.
 Worm   471 NMWIGPQDTVSPLHTDPRKNMFVQVHGTKLFRMVAPESSESVYPFDG-ILSNTSQVDVENPDLKI 534

  Fly   358 YPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWWE 401
            :|...:|:....::.|||.:::|.||||:|||.:||.|:|||::
 Worm   535 FPNFEQVEVLDAVINPGDAIFIPEKWWHFVRSTSPSISISFWFD 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 86/233 (37%)
jmjd-5NP_505831.1 LPLAT 12..>92 CDD:302626
Acetyltransf_1 55..123 CDD:278980
Cupin_8 360..578 CDD:290351 86/234 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C291546462
eggNOG 1 0.900 E1_KOG2132
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 193 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006582
OrthoInspector 1 1.000 T476583
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 1 0.910 0.721 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3673
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.