DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Hspbap1

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_599246.2 Gene:Hspbap1 RGDID:620870 Length:479 Species:Rattus norvegicus

Alignment Length:251 Identity:66/252 (26%)
Similarity:100/252 (40%) Gaps:50/252 (20%)


  Fly   183 QPTLLLNTIQHWPALHKWL-----------DLNYLLQVAGNRTVP-IEIGSNYASDEWSQQLVKI 235
            ||.:..|.:..||:.| |.           .:.:.:.:....||| .|...:|..       ..:
  Rat    42 QPAIFCNMVFDWPSRH-WTAKHLSKVLEGKQIRFRMGLRSTGTVPQFETECSYVD-------ATL 98

  Fly   236 RDFL---------SRQFGK-EPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPG-- 288
            .:||         |..|.| :.||.....:|.....||.....:.:::...|:      ..||  
  Rat    99 EEFLAWNCDQSRISGPFKKYDHSKFWAYADYKYFVTLFEDKTDVFQEVMWSDF------GFPGRN 157

  Fly   289 AVDIKAWLGPAGTVSPMHYDPKH-NLLCQVFGSKRIILAAPADTDNLYP------HDSEFLANTA 346
            ..:...|:|..|..:|.|.|... ||:.||.|.||..|..|.||..|||      ..|.|    :
  Rat   158 GQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVF----S 218

  Fly   347 RIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAP-SFSVSFWWE 401
            :|:....|.:.:|...|.:.:.:.|.||..|::|..|||||.|..| :.|::.|.|
  Rat   219 KINVVNPDLKRFPQFQKARRHMVTLSPGQVLFVPRHWWHYVESLDPVTVSINSWIE 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 65/250 (26%)
Hspbap1NP_599246.2 Cupin_8 37..272 CDD:290351 64/248 (26%)
Interaction with HSPB1. {ECO:0000269|PubMed:10751411} 88..208 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.