powered by:
Protein Alignment: JMJD5 and CG43319
Sequence 1: | NP_612063.2 |
Gene: | JMJD5 |
FlyBaseID: | FBgn0035166 |
Length: | 401 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001247340.1 |
Gene: | CG43319 |
FlyBaseID: | FBgn0263024 |
Length: | 57 |
Species: | Drosophila melanogaster |
Alignment Length: | 36 |
Identity: | 10/37 (27%) |
Similarity: | 16/37 (43%) |
Gaps: | 3/37 (8%) |
Fly 229 SQQLVKIRDFLSRQFGKEP--SKAGQNIEYLAQHEL 262
|.|..|.:.:...:.||.. .|.| |.|.:..:|:
Fly 19 SGQKGKWKGYKDEEMGKSSYWKKVG-NAESIVGNEI 53
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
JMJD5 | NP_612063.2 |
Cupin_8 |
172..401 |
CDD:290351 |
10/37 (27%) |
CG43319 | NP_001247340.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_KOG2132 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.