DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and tyw5

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_017952962.1 Gene:tyw5 XenbaseID:XB-GENE-6041227 Length:346 Species:Xenopus tropicalis

Alignment Length:322 Identity:77/323 (24%)
Similarity:118/323 (37%) Gaps:110/323 (34%)


  Fly    97 LESTSPAQKDACSEILDEAQLLGCMEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNC 161
            |:...|.:|..   ::....|..|...|:      :||:.|.|.         :.|....|:   
 Frog    51 LQDIYPLRKPV---VVKGLHLGACSTKWT------VDYISKTGG---------SKEVKIHVS--- 94

  Fly   162 DIPQLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASD 226
            ::||:|                                ::..|:|.     ||:|.:|....|::
 Frog    95 ELPQMD--------------------------------FIRKNFLY-----RTLPFDIFVQRAAE 122

  Fly   227 EWSQQLVKIRDFLS-------RQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPD------- 277
            |.....     |:|       |..|::|.|...:|.        .|.|.|..||.||:       
 Frog   123 EKHTAF-----FISENEKYYLRSLGEDPRKDIADIS--------KQFPHLATDIQIPEFFEKDQF 174

  Fly   278 YCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLY--PHDSE 340
            :.::....:||   ::.|         .|||...|||.||.|.||::|.:|.|...||  ...||
 Frog   175 FSSVFRISSPG---LQLW---------THYDVMDNLLIQVTGKKRVVLYSPRDAPYLYLSGDKSE 227

  Fly   341 FLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVS---FW 399
            .|      |....|...|||.:..:.|:..|:.||.|::|..|:|  .:.|..|.|.   ||
 Frog   228 VL------DVDNTDLVKYPLFSHARRYECYLEAGDVLFIPALWFH--NTVAVGFGVGVNVFW 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 62/248 (25%)
tyw5XP_017952962.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.