DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and hspbap1

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_017945598.1 Gene:hspbap1 XenbaseID:XB-GENE-997370 Length:474 Species:Xenopus tropicalis

Alignment Length:275 Identity:64/276 (23%)
Similarity:113/276 (41%) Gaps:65/276 (24%)


  Fly   183 QPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEI--------------GSNY---------- 223
            ||.:..:.:..||| ..| ::.||..|.....:...|              |||:          
 Frog    30 QPVVFHHMVSDWPA-SAW-NVGYLSSVLSENPLCFRIGKKALDTGESFQYQGSNFLCFSQYCLGG 92

  Fly   224 ----ASDEWSQQLVKIRDFLSRQFGKEPS-----KAGQNIEYLAQHEL---FAQIPALKEDISIP 276
                :||:.|     :.|...:....:|:     :|.|::...|...|   .||  |::.::...
 Frog    93 KGGLSSDQSS-----VIDTAGKPLSHKPNWSLGKRAAQSLGKRAAQSLGKRAAQ--AVQSNVCAT 150

  Fly   277 DYCTISNEDTPGAV----------------DIKAWLGPAGTVSPMHYDPKH-NLLCQVFGSKRII 324
            .|.::.|:..|.:|                :...|:|.:|..:|.|.|... ||:.||.|.|...
 Frog   151 LYRSVGNDSVPVSVQDVVWADFGFPGRDGKESSLWVGSSGANTPCHVDSYGCNLVLQVQGRKTWH 215

  Fly   325 LAAPADTDNLYPHDSEFLANT--ARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYV 387
            |..|.||.::||....:..::  ::::....|...:||.::...:.:.|.||..|.:|..|||||
 Frog   216 LYPPGDTPHMYPTRIPYEESSIFSKVNVVNPDRSRFPLFSRTSPHVVTLHPGQVLLVPRHWWHYV 280

  Fly   388 RS-EAPSFSVSFWWE 401
            :| :..:.|::.|.|
 Frog   281 QSVDDMTVSINSWIE 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 63/274 (23%)
hspbap1XP_017945598.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.