DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and kdm8

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001121525.1 Gene:kdm8 XenbaseID:XB-GENE-5811534 Length:443 Species:Xenopus tropicalis

Alignment Length:406 Identity:135/407 (33%)
Similarity:205/407 (50%) Gaps:70/407 (17%)


  Fly    52 ETGYLVGALVDRNWERIHTGHFSQVPLVTRKIYAIACCFKIFFL--------------------- 95
            :.|.|...|:|.:||:::..::.:|....|.:|:..|.|:...|                     
 Frog    50 QCGALGELLIDYSWEKLNARNWREVGREWRAVYSYGCLFRAVGLCSVTGSIEEALQVCDIGLLMG 114

  Fly    96 -------------LLESTSPAQKDACSEI--------LDEAQLLGCMEDWSELKVALM------- 132
                         :|:..:|::::...|.        |:.::|....|..::...|.:       
 Frog   115 AEIMDNLLGRIISVLQRIAPSREETKLEAERGVREPGLESSKLHSPGEHSNKKSFASVTGRKRIR 179

  Fly   133 -----DYLDKDGAVALNSAP---LPTLEPLTRVTSNCDIPQLDAPSLEEFQTKCFEAGQPTLLLN 189
                 |: |..|.......|   :|.|:      |...||:|..||||.|:.......:|.:|..
 Frog   180 EGPEADF-DPKGCSISEKVPCLLVPVLD------SETAIPKLHCPSLEHFRDHYLVPQKPVVLEG 237

  Fly   190 TIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLSRQFGKEPSKAGQNI 254
            .|.|||.|.|| .:.|:.:|||.||||:|:||.|...||||:|:.:.:|:::....:.:..|   
 Frog   238 VIDHWPCLKKW-SVEYIQRVAGCRTVPVELGSRYTDAEWSQRLMTVNEFITKYILDKQNGIG--- 298

  Fly   255 EYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFG 319
             |||||:||.|||.|||||.|||||.: .|.:...:.|.||.||||||||:|.||:.|.|.|:.|
 Frog   299 -YLAQHQLFEQIPELKEDICIPDYCCL-GEASEDEITINAWFGPAGTVSPLHQDPQQNFLAQIVG 361

  Fly   320 SKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWW 384
            .|.|.:.:.|:|:.|||.||..|.||:::|....|...:|..::..:.:.:|.||..|::|.|||
 Frog   362 RKYIRVYSVAETEKLYPFDSSILHNTSQVDVESPDQNKFPRFSQASYQECILSPGQVLFIPVKWW 426

  Fly   385 HYVRSEAPSFSVSFWW 400
            ||:|:...||||||||
 Frog   427 HYIRALDLSFSVSFWW 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 103/230 (45%)
kdm8NP_001121525.1 Cupin_8 222..443 CDD:290351 102/228 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292020815
eggNOG 1 0.900 E1_KOG2132
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 260 1.000 Inparanoid score I2911
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 1 1.000 FOG0006582
OrthoInspector 1 1.000 T1061329
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3673
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.