DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Jmjd7

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001108128.1 Gene:Jmjd7 RGDID:2290039 Length:316 Species:Rattus norvegicus

Alignment Length:277 Identity:73/278 (26%)
Similarity:114/278 (41%) Gaps:50/278 (18%)


  Fly   163 IPQLDAPSLEEFQTKCFE-----AGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSN 222
            :|.||.|.    ...||.     ..:|.::.|.:||||||.|| ..:||....|:..|.:.:   
  Rat    29 VPYLDEPP----SPLCFYRDWVCPNRPCIIRNALQHWPALQKW-SFSYLRATVGSTEVSVAV--- 85

  Fly   223 YASDEWSQQLVKIRDFLSRQFGKEPSKAGQNIEYLAQH-----------ELFAQIPALKEDIS-- 274
             ..|.::..:...|..:..:.....|.....:|..|||           .|..::|.|..||.  
  Rat    86 -TPDGYADAVRGDRFVMPAERRLPVSHVLDVLEGQAQHPGVLYVQKQCSNLPTELPQLLSDIESH 149

  Fly   275 IPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTD----NLY 335
            :| :.:.|....|.||:.  |||.|..|:.:|.|...||.|.|.|.|..:|..|:|..    |||
  Rat   150 VP-WASESLGKMPDAVNF--WLGDAAAVTSLHKDHYENLYCVVSGEKHFLLHPPSDRPFIPYNLY 211

  Fly   336 PH--------------DSEFLANTARIDAAQLDPE--TYPLVAKVKFYQLLLQPGDCLYMPPKWW 384
            ..              |.|.:.....|....|.|:  .||..::.:.....::.|:.||:|..|:
  Rat   212 TPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLARYPSYSQARALHCTVRAGELLYLPALWF 276

  Fly   385 HYVRSEAPSFSVSFWWE 401
            |:|:......:|:||::
  Rat   277 HHVQQSHGCIAVNFWYD 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 69/267 (26%)
Jmjd7NP_001108128.1 Cupin_8 38..297 CDD:290351 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.