DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13887 and bcap31

Sequence 1:NP_001286891.1 Gene:CG13887 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_956386.1 Gene:bcap31 ZFINID:ZDB-GENE-030616-63 Length:247 Species:Danio rerio

Alignment Length:237 Identity:100/238 (42%)
Similarity:149/238 (63%) Gaps:20/238 (8%)


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLE 65
            |||.||.:|.|||||:..||||.:|.::|.||::||||:.::.:....:..|::|:.|||..|::
Zfish     1 MSLQWTAVATFLYAEVLAVLLLCVPFISPKRWSKFFKSRLVTAITSYGNTAFIVIICILVFLLID 65

  Fly    66 AIREMRKYSGLQQSNEVHLNVEMQH-SMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMA 129
            |.||:||||..::.:..:..|.::| .|||||||||.||:|||:.|.|::|||..|:..||.|||
Zfish    66 AFREVRKYSVAEKVDLSNNPVAIEHIHMKLFRAQRNEYIAGFALLLCLLLRRLATLLSQQATLMA 130

  Fly   130 QSEASFKQAQSATAAARSLLE--NKNTEKAKEAGEDTTLI----------ELNKLRERVQELTSD 182
            ..||..|||:.|..||:..:|  .|..||.::||.:...:          :...|:|.|::|..:
Zfish   131 SHEAFQKQAEGANDAAKKYMEENEKLQEKLRQAGIEVPEVGGKAKGGMEEDKKNLKEEVRQLKDE 195

  Fly   183 LNREKK-------DKEAVKSQAESINREYDRLTEEYSKLQKK 217
            |:..||       |.:|:|.|||::..|||||.||:::||.|
Zfish   196 LDATKKALQKSDSDVKAMKKQAENLTTEYDRLLEEHARLQAK 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 92/224 (41%)
bcap31NP_956386.1 Bap31 1..225 CDD:283239 92/224 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C357913557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H38095
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1514108at2759
OrthoFinder 1 1.000 FOG0001340
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128681
Panther 1 1.100 LDO PTHR12701
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.