DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and VTI1

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_013924.1 Gene:VTI1 SGDID:S000004810 Length:217 Species:Saccharomyces cerevisiae

Alignment Length:232 Identity:66/233 (28%)
Similarity:118/233 (51%) Gaps:31/233 (13%)


  Fly     2 SLLEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVREL--NP 64
            |||..||..:.|.:.:..|.:.....| ..|:|:.....::....|..:||:||.:||...  :.
Yeast     3 SLLISYESDFKTTLEQAKASLAEAPSQ-PLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDA 66

  Fly    65 GLRSSFNGKL----QVAQAELKR-LQAEYRLTKDKQRSQANTFTTLDLGDS---YEDV---SIST 118
            ..|:::..||    :..|:::|| ||                 :.:|.||.   :.|:   :|..
Yeast    67 SERATYKAKLREWKKTIQSDIKRPLQ-----------------SLVDSGDRDRLFGDLNASNIDD 114

  Fly   119 DQRQRLLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRA 183
            ||||:||.|...::::|:||.:..|:|.|||.:|:|::.||..|||||:.||..|.:.::.:.::
Yeast   115 DQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKS 179

  Fly   184 SRTLNTMMLRALREKVVLYGVGVCFVVAVGVSLYLTF 220
            .:||.||..|.:..|.:.|.:....::.:.:.|:..|
Yeast   180 IKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKF 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 20/85 (24%)
SNARE_Vti1a 128..189 CDD:277244 22/61 (36%)
VTI1NP_013924.1 V-SNARE 12..92 CDD:309928 19/81 (23%)
SNARE_Vti1 127..185 CDD:277215 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42495978
eggNOG 1 0.900 E1_KOG1666
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003559
OrthoInspector 1 1.000 T1136848
orthoMCL 1 0.900 OOG5_127758
Panther 1 1.100 O PTHR21230
Phylome 1 0.910 0.734 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1665
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.