DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and VTI1

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_013924.1 Gene:VTI1 / 855237 SGDID:S000004810 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:66/232 - (28%)
Similarity:118/232 - (50%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVREL--NP 64
            |||..||..:.|.:.:..|.:.....| ..|:|:.....::....|..:||:||.:||...  :.
Yeast     3 SLLISYESDFKTTLEQAKASLAEAPSQ-PLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDA 66

  Fly    65 GLRSSFNGKL----QVAQAELKR-LQAEYRLTKDKQRSQANTFTTLDLGDS---YEDV---SIST 118
            ..|:::..||    :..|:::|| ||                 :.:|.||.   :.|:   :|..
Yeast    67 SERATYKAKLREWKKTIQSDIKRPLQ-----------------SLVDSGDRDRLFGDLNASNIDD 114

  Fly   119 DQRQRLLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRA 183
            ||||:||.|...::::|:||.:..|:|.|||.:|:|::.||..|||||:.||..|.:.::.:.::
Yeast   115 DQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKS 179

  Fly   184 SRTLNTMMLRALREKVVLYGVGVCFVVAVGVSLYLTF 220
            .:||.||..|.:..|.:.|.:....::.:.:.|:..|
Yeast   180 IKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 20/84 (24%)
SNARE_Vti1a 128..189 CDD:277244 22/60 (37%)
VTI1NP_013924.1 V-SNARE 12..92 CDD:398604 18/80 (23%)
SNARE_Vti1 127..185 CDD:277215 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342087
Domainoid 1 1.000 55 1.000 Domainoid score I2738
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1542
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54893
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - oto99040
orthoMCL 1 0.900 - - OOG6_101479
Panther 1 1.100 - - O PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1665
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.