DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and NPSN11

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_565800.1 Gene:NPSN11 AraportID:AT2G35190 Length:265 Species:Arabidopsis thaliana

Alignment Length:220 Identity:41/221 (19%)
Similarity:93/221 (42%) Gaps:12/221 (5%)


  Fly     4 LEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRS 68
            |.:.|.|...:...::....:|::..:.:.:.....::...:.:.:.|::....|::.|..|..:
plant    11 LAEIEGQINDIFRALSNGFQKLEKIKDANRQSRQLEELTDKMRDCKSLIKDFDREIKSLESGNDA 75

  Fly    69 SFNGKL-QVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDS------YEDVSISTD-QRQRLL 125
            |.|..| ...|:.:|.|.:...|.|....:.|:....:||.|.      .|:|.:::: ..|.|:
plant    76 STNRMLNDRRQSMVKELNSYVALKKKYSSNLASNNKRVDLFDGPGEEHMEENVLLASNMSNQELM 140

  Fly   126 D-NSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNT 189
            | .:..::.|...:..|.::..||..:|......|..|.|.:......|...:..|.:||:.:..
plant   141 DKGNSMMDDTDQAIERGKKIVQETINVGTDTSAALKAQTEQMSRVVNELDSIHFSLKKASKLVKE 205

  Fly   190 MMLRALREKVVLYGVGVCFVVAVGV 214
            :..:...:|.::   ...|::.:||
plant   206 IGRQVATDKCIM---AFLFLIVIGV 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 11/79 (14%)
SNARE_Vti1a 128..189 CDD:277244 12/61 (20%)
NPSN11NP_565800.1 SNARE_SNAP25N_23N_29N_SEC9N 141..205 CDD:277214 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21230
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.