DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and Vti1a

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_075589.1 Gene:Vti1a RGDID:621490 Length:217 Species:Rattus norvegicus

Alignment Length:220 Identity:83/221 (38%)
Similarity:140/221 (63%) Gaps:17/221 (8%)


  Fly     5 EQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSS 69
            |.|||.:|.|.||||:.|.|:.:...: |:..:.:.::..|.||:||||||.|||||:.|..|..
  Rat     6 EGYEQDFAVLTAEITSKISRVPRLPPD-EKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGM 69

  Fly    70 FNGKLQVAQAELKRLQAEYRLTK----DKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLDNSER 130
            ::.:::..:.|:.:|:.:::.::    |:.|::.       |||:...   |.:||..||||:||
  Rat    70 YSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNEL-------LGDAGNS---SENQRAHLLDNTER 124

  Fly   131 IERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRAL 195
            :||:..||..||::|:||||:|.::|.:|.|.||.:|.||.|||||:|.||::||.|..|:.|.:
  Rat   125 LERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDANLGKSSRILTGMLRRII 189

  Fly   196 REKVVLYGVGVCFVVAVGVSLYLTF 220
            :.:::|..:|:  :|.:.:...:||
  Rat   190 QNRILLVILGI--IVVITILTAITF 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 27/78 (35%)
SNARE_Vti1a 128..189 CDD:277244 33/61 (54%)
Vti1aNP_075589.1 V-SNARE 12..90 CDD:282816 27/78 (35%)
SNARE_Vti1a 122..183 CDD:277244 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42479916
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H39963
Inparanoid 1 1.050 150 1.000 Inparanoid score I4223
OMA 1 1.010
OrthoDB 1 1.010 D1195966at2759
OrthoFinder 1 1.000 FOG0003559
OrthoInspector 1 1.000 T1088935
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21230
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.