DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and Vti1a

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006527247.1 Gene:Vti1a MGIID:1855699 Length:292 Species:Mus musculus

Alignment Length:190 Identity:74/191 (39%)
Similarity:121/191 (63%) Gaps:2/191 (1%)


  Fly     5 EQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSS 69
            |.|||.:|.|.||||:.|.|:.:...: |:..:.:.::..|.||:||||||.|||||:.|..|..
Mouse     6 EGYEQDFAVLTAEITSKIARVPRLPPD-EKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGM 69

  Fly    70 FNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSIS-TDQRQRLLDNSERIER 133
            ::.:::..:.|:.:|:.:::.::.....:.......|.|:|.|:..|. .::|..||||:||:||
Mouse    70 YSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQLIKLREERAHLLDNTERLER 134

  Fly   134 TGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLR 193
            :..||..||::|:||||:|.::|.:|.|.||.:|.||.|||:.:|.||::||.|..|:.|
Mouse   135 SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADANLGKSSRILTGMLRR 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 27/78 (35%)
SNARE_Vti1a 128..189 CDD:277244 31/61 (51%)
Vti1aXP_006527247.1 V-SNARE 12..90 CDD:282816 27/78 (35%)
SNARE_Vti1a 129..190 CDD:277244 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42480334
eggNOG 1 0.900 E1_KOG1666
Hieranoid 1 1.000
Homologene 1 1.000 H39963
Inparanoid 1 1.050 148 1.000 Inparanoid score I4361
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1195966at2759
OrthoFinder 1 1.000 FOG0003559
OrthoInspector 1 1.000 T1085388
orthoMCL 1 0.900 OOG5_127758
Panther 1 1.100 LDO PTHR21230
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1665
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.