DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and Vti1b

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001138075.1 Gene:Vti1b FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster

Alignment Length:118 Identity:31/119 (26%)
Similarity:59/119 (50%) Gaps:10/119 (8%)


  Fly   111 YEDVSISTDQRQR----LLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARA 171
            |..:...:||.:|    .....:.::||.:.:....::|:|||.:||:||.:|..|||:|.....
  Fly     6 YSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENMGAEVLGELGEQRESLLRTTR 70

  Fly   172 RLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVVAVGV---SLYLTFA 221
            ||.:.:.:|.::...:..:....|..|::|.   :..::.||:   .|.|.||
  Fly    71 RLEDADQDLSKSRVIIRKLSREVLYNKIILI---LIIILEVGILVGLLVLKFA 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816
SNARE_Vti1a 128..189 CDD:277244 18/61 (30%)
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42483978
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21230
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.