DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and Membrin

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_647960.1 Gene:Membrin FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster

Alignment Length:233 Identity:49/234 (21%)
Similarity:103/234 (44%) Gaps:40/234 (17%)


  Fly     4 LEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRS 68
            :|....|...::.:|.....||.|. :..|..|:.:.|...:.:|....:::.:.:.::.|..|.
  Fly     1 MESLYHQTNNVVKDIERDFQRLSQL-SAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQ 64

  Fly    69 SFNGKLQVAQA--ELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLD----- 126
            |  .||:|.|.  :|:.||...:..:::::.:            .:::|    :|::||:     
  Fly    65 S--SKLRVDQLKYDLRHLQTSLQTARERRQRR------------MQEIS----EREQLLNHRFTA 111

  Fly   127 NSERIERTGNRLTEGYRVALETE------------QLGAQVLNDLHHQRETLQGARARLRETNAE 179
            ||.:.|.|  ||...|.:...|:            ..|:.:|..|..||.||.||..|::...:.
  Fly   112 NSAQPEET--RLQLDYELQHHTQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGST 174

  Fly   180 LGRASRTLNTMMLRALREKVVLYGVGVCFVVAVGVSLY 217
            ||.::.|:..:..|.:.::.:..|..|..::.:.:.:|
  Fly   175 LGLSNHTMKLIERRLVEDRRIFIGGVVVTLLIIALIIY 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 18/80 (23%)
SNARE_Vti1a 128..189 CDD:277244 20/73 (27%)
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21230
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.