| Sequence 1: | NP_612053.1 | Gene: | Vti1a / 38085 | FlyBaseID: | FBgn0260862 | Length: | 230 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006361.1 | Gene: | VTI1B / 10490 | HGNCID: | 17793 | Length: | 232 | Species: | Homo sapiens | 
| Alignment Length: | 205 | Identity: | 52/205 - (25%) | 
|---|---|---|---|
| Similarity: | 91/205 - (44%) | Gaps: | 15/205 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    24 RLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSSFNGKLQVAQAELKRLQAEY 88 
  Fly    89 RLTKDKQRSQANTFTTLDLGD--------SYEDVSISTDQRQRLLDNSERIERTGNRLTEGYRVA 145 
  Fly   146 LETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVV 210 
  Fly   211 AVGVSLYLTF 220 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Vti1a | NP_612053.1 | V-SNARE | 11..89 | CDD:282816 | 18/64 (28%) | 
| SNARE_Vti1a | 128..189 | CDD:277244 | 17/60 (28%) | ||
| VTI1B | NP_006361.1 | Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S | 2..23 | ||
| V-SNARE | 18..96 | CDD:309928 | 18/71 (25%) | ||
| Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S | 69..73 | 0/3 (0%) | |||
| SNARE_Vti1b | 136..197 | CDD:277243 | 17/60 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1666 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG54893 | |
| OrthoDB | 1 | 1.010 | - | - | D1195966at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.830 | |||||