DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and VTI1B

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_006361.1 Gene:VTI1B HGNCID:17793 Length:232 Species:Homo sapiens

Alignment Length:205 Identity:52/206 (25%)
Similarity:91/206 (44%) Gaps:15/206 (7%)


  Fly    24 RLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSSFNGKLQVAQAELKRLQAEY 88
            ||.......|:..|....|....||.|.|.:|..|:|......|:....||:..:.:|.:|..|.
Human    31 RLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV 95

  Fly    89 RLTKDKQRSQANTFTTLDLGD--------SYEDVSISTDQRQRLLDNSERIERTGNRLTEGYRVA 145
                   ||...|.|....||        ..|.::....||..||..:|.:.|....:...:|:|
Human    96 -------R
STPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIA 153

  Fly   146 LETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVV 210
            .||:|:|::::.:|..||:.|:..::||..|:..|.::.:.|.:|..:....|::|..:.:..:.
Human   154 TETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA 218

  Fly   211 AVGVSLYLTF 220
            .:|..:|..|
Human   219 ILGGLVYYKF 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 18/65 (28%)
SNARE_Vti1a 128..189 CDD:277244 17/61 (28%)
VTI1BNP_006361.1 Interaction with CLINT1. {ECO:0000244|PDB:2V8S, ECO:0000269|PubMed:18033301} 2..23
V-SNARE 18..96 CDD:309928 18/72 (25%)
Interaction with CLINT1. {ECO:0000244|PDB:2V8S, ECO:0000269|PubMed:18033301} 69..73 0/4 (0%)
SNARE_Vti1b 136..197 CDD:277243 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1666
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195966at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127758
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.