DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vti1a and Vti1b

Sequence 1:NP_612053.1 Gene:Vti1a FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_017458745.1 Gene:Vti1b RGDID:2323682 Length:232 Species:Rattus norvegicus

Alignment Length:225 Identity:58/226 (26%)
Similarity:101/226 (45%) Gaps:16/226 (7%)


  Fly     5 EQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSS 69
            |:..:.:..|:.::.....||.......|:..|....|....||.|.|.:|..|:|......|:|
  Rat    12 EKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNS 76

  Fly    70 FNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGD----SY----EDVSISTDQRQRLLD 126
            ...||:..:.:|.:|..|.       ||...|.|....||    :|    |.::....||..||.
  Rat    77 MMSKLRNYRKDLAKLHREV-------RSTPLTATPGGRGDLKFGTYTLENEHLNRLQSQRALLLQ 134

  Fly   127 NSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMM 191
            .:|.:.|....:...:|:|.||:|:|::::.:|..||:.|:..::||..||..|.::.:....|.
  Rat   135 GTESLNRATQSIERSHRIAAETDQIGSEIIEELGEQRDQLERTKSRLVNTNENLSKSRKIFRFMS 199

  Fly   192 LRALREKVVLYGVGVC-FVVAVGVSLYLTF 220
            .:.:..|::|..:.|. ..:.||:..|..|
  Rat   200 RKVITNKLLLSVIIVLELAILVGLVYYKFF 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 20/78 (26%)
SNARE_Vti1a 128..189 CDD:277244 17/61 (28%)
Vti1bXP_017458745.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195966at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.