powered by:
Protein Alignment CG3402 and SLC9A3R2
DIOPT Version :9
Sequence 1: | NP_612045.1 |
Gene: | CG3402 / 38077 |
FlyBaseID: | FBgn0035148 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016879383.1 |
Gene: | SLC9A3R2 / 9351 |
HGNCID: | 11076 |
Length: | 372 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 23/63 - (36%) |
Similarity: | 36/63 - (57%) |
Gaps: | 8/63 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 KKSPQGY--------TDYGIYVTEVHEGSPAARAGLRIHDKILQCNGYDFTMVTHKKAVSYIR 106
:|.|||| :..|.|:..|..||||||:|||..|::::.||.:...:.|.:.|:.|:
Human 201 RKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIK 263
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3402 | NP_612045.1 |
PDZ_signaling |
21..116 |
CDD:238492 |
23/63 (37%) |
SLC9A3R2 | XP_016879383.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.