DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:63 Identity:23/63 - (36%)
Similarity:36/63 - (57%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KKSPQGY--------TDYGIYVTEVHEGSPAARAGLRIHDKILQCNGYDFTMVTHKKAVSYIR 106
            :|.||||        :..|.|:..|..||||||:|||..|::::.||.:...:.|.:.|:.|:
Human   201 RKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 23/63 (37%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.