DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and Tax1bp3

DIOPT Version :8

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_006246823.1 Gene:Tax1bp3 / 360564 RGDID:1308924 Length:124 Species:Rattus norvegicus

Alignment Length:104 Identity:47/104 - (45%)
Similarity:66/104 - (63%) Gaps:9/104 - (8%)


  Fly    21 ITLHKEKDYDQEGREILKCGFKIGGGIDQDYKKSP--QGYTDYGIYVTEVHEGSPAARAGLRIHD 83
            :.:||.:    :|..:: .||.||||||||..::|  :..||.|||||.|.||.||..|||:|.|
  Rat    16 VEIHKLR----QGENLI-LGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGD 75

  Fly    84 KILQCNGYDFTMVTHKKAVSYI--RKNPILNMLVARKGV 120
            ||:|.||:|.|||||.:|...:  |...::.:||.|:.:
  Rat    76 KIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSL 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 45/98 (46%)
Tax1bp3XP_006246823.1 PDZ_signaling 13..109 CDD:238492 44/97 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190996407
eggNOG 1 0.900 E1_KOG3553
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1471323at2759
OrthoFinder 1 1.000 FOG0006226
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23136
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.