DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and GEP4

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_011968.1 Gene:GEP4 SGDID:S000001142 Length:185 Species:Saccharomyces cerevisiae

Alignment Length:197 Identity:43/198 (22%)
Similarity:67/198 (34%) Gaps:70/198 (35%)


  Fly   102 NHLIELYKTSICWQ------------PCNGSVELLQQLRKELKPEKCKLGVIANFDPRL-PTLLQ 153
            |.|..||..|:|..            |.:.|::.:     .|..:.|   :....|.:: |..||
Yeast     8 NTLRLLYNPSLCKPSLVVPTFNDLPIPIHDSIKAV-----VLDKDNC---IAFPHDDKIWPDYLQ 64

  Fly   154 N--TKLDQYLDFAI----NSYEVQAEKPDPQ-----------IFQKAMEKSGLKN---------- 191
            :  |...:|.:.|:    |:....::|...|           :.:.:.:|.|..|          
Yeast    65 HWETLRSKYSNKALLIVSNTAGSNSDKDYSQAKLLEDKTGIPVLRHSTKKPGCHNEILDYFYRNK 129

  Fly   192 --LKPEECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYGEDIDRDHVFPS---LYDFHK 251
              ..|:|...:||...||.|.|..:|                .||..| ||.|..|   |..|.|
Yeast   130 TITNPKEVAVVGDRLFTDILMANLMG----------------SYGVWI-RDGVKVSANPLSKFEK 177

  Fly   252 KI 253
            |:
Yeast   178 KL 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 32/160 (20%)
HAD_like 76..215 CDD:304363 31/155 (20%)
GEP4NP_011968.1 PGP_phosphatase 3..166 CDD:286502 38/183 (21%)
HAD-SF-IIIA 40..163 CDD:273742 28/148 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.