DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and DPI35

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_013849.1 Gene:DPI35 / 855160 SGDID:S000004737 Length:302 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:72/249 - (28%)
Similarity:113/249 - (45%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTN 68
            ::|..:||||..|||...:....:||..:|..:|.:.:.:.|..||...:.|:..|||.:|:.:.
Yeast    18 VARPLIITFDAYNTLYATKLPVMEQYCIVGRKYGIKANPSTLTNNFPHVFKKLKEDYPQYGKYSG 82

  Fly    69 PQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKP 133
            .:.|  |||..||...||.:  .||||.:    |.::..::....:......::.|:.| |...|
Yeast    83 IKPE--QWWSILIRNVFAPN--EIPDEMI----NEILMRFEGFDSYFVYPDLIKFLKDL-KSRHP 138

  Fly   134 EKCKLGVIANFDPRLPTLLQNTKLDQ------YLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNL 192
            :.. ||:::|.||....||:|..|.:      ||     |||:...|||..|||.|::  .:.:.
Yeast   139 DVI-LGIVSNTDPIFYKLLKNIGLFETFSGHIYL-----SYELNLAKPDRAIFQYALD--DIISK 195

  Fly   193 KP------------EECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYG 234
            :|            :.|.||||....|...|:..||...|:....      |||
Yeast   196 QPHLLEKYTREEILQHCFHIGDELKNDLEGAEAAGWTGILLDRND------KYG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 67/229 (29%)
HAD_like 76..215 CDD:304363 44/156 (28%)
DPI35NP_013849.1 DREG-2 23..235 CDD:274056 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39934
Inparanoid 1 1.050 85 1.000 Inparanoid score I1588
Isobase 1 0.950 - 0 Normalized mean entropy S2956
OMA 1 1.010 - - QHG55252
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - otm46700
orthoMCL 1 0.900 - - OOG6_102573
Panther 1 1.100 - - LDO PTHR46191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1833
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.