DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and YMR130W

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_013849.1 Gene:YMR130W SGDID:S000004737 Length:302 Species:Saccharomyces cerevisiae

Alignment Length:249 Identity:72/250 (29%)
Similarity:113/250 (45%) Gaps:41/250 (16%)


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTN 68
            ::|..:||||..|||...:....:||..:|..:|.:.:.:.|..||...:.|:..|||.:|:.:.
Yeast    18 VARPLIITFDAYNTLYATKLPVMEQYCIVGRKYGIKANPSTLTNNFPHVFKKLKEDYPQYGKYSG 82

  Fly    69 PQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKP 133
            .:.|  |||..||...||.:  .||||.:    |.::..::....:......::.|:.| |...|
Yeast    83 IKPE--QWWSILIRNVFAPN--EIPDEMI----NEILMRFEGFDSYFVYPDLIKFLKDL-KSRHP 138

  Fly   134 EKCKLGVIANFDPRLPTLLQNTKLDQ------YLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNL 192
            :.. ||:::|.||....||:|..|.:      ||     |||:...|||..|||.|::  .:.:.
Yeast   139 DVI-LGIVSNTDPIFYKLLKNIGLFETFSGHIYL-----SYELNLAKPDRAIFQYALD--DIISK 195

  Fly   193 KP------------EECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYG 234
            :|            :.|.||||....|...|:..||...|:....      |||
Yeast   196 QPHLLEKYTREEILQHCFHIGDELKNDLEGAEAAGWTGILLDRND------KYG 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 67/230 (29%)
HAD_like 76..215 CDD:304363 44/157 (28%)
YMR130WNP_013849.1 DREG-2 23..235 CDD:274056 67/229 (29%)
HAD-SF-IA-v1 23..230 CDD:273686 65/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 1 1.000
Homologene 1 1.000 H39934
Inparanoid 1 1.050 85 1.000 Inparanoid score I1563
Isobase 1 0.950 0 Normalized mean entropy S2956
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003230
OrthoInspector 1 1.000 T634724
orthoMCL 1 0.900 OOG5_128559
Panther 1 1.100 LDO PTHR46191
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1833
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.