powered by:
Protein Alignment Reg-2 and SDT1
DIOPT Version :9
Sequence 1: | NP_612043.1 |
Gene: | Reg-2 / 38075 |
FlyBaseID: | FBgn0016715 |
Length: | 260 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011291.1 |
Gene: | SDT1 / 852648 |
SGDID: | S000003192 |
Length: | 280 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 14/55 - (25%) |
Similarity: | 25/55 - (45%) |
Gaps: | 19/55 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 KPDPQIFQKAMEKSGL-------------KNLKP------EECLHIGDGPTTDYL 209
||..:.|:|||::||| ||::. :.|:|:.:....:.|
Yeast 202 KPHVKAFEKAMKESGLARYENAYFIDDSGKNIETGIKLGMKTCIHLVENEVNEIL 256
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157342026 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1011 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.