DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and AT1G14310

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_172883.2 Gene:AT1G14310 AraportID:AT1G14310 Length:254 Species:Arabidopsis thaliana

Alignment Length:251 Identity:61/252 (24%)
Similarity:100/252 (40%) Gaps:53/252 (21%)


  Fly    10 ITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFK----ANWYKMNRDYPNFGRDTNPQ 70
            :..|...||||......:.|..:|..:|.:....|:.:.||    |.|.:..| |...||     
plant    45 LLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKEGFKRVFSAPWPEKLR-YQGDGR----- 103

  Fly    71 MEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEK 135
                .:|:.:::   ..:|.:..|     :...:.:.|.....|....|:.|.:..    ||...
plant   104 ----PFWKLVVS---EATGCSDND-----YFEDVYQYYANGEAWHLPEGAYETMSL----LKDAG 152

  Fly   136 CKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHI 200
            .|:.|::|||.||..||::..:....|..|.|.||..||||.:||:.|:|:.   ::.....:|:
plant   153 VKMAVVSNFDTRLRKLLKDLNVIDMFDAVIVSAEVGYEKPDERIFKSALEQI---SVDVNRAVHV 214

  Fly   201 GDGPTTDYLAAKELG---WHSALVHEKSYAYLVKKYGEDIDRDHVFPSLYDFHKKI 253
            ||....|...|..:|   |               .:|||:.      :..|..|:|
plant   215 GDDEGADKGGANAIGIACW---------------LWGEDVQ------TFSDIQKRI 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 55/217 (25%)
HAD_like 76..215 CDD:304363 36/139 (26%)
AT1G14310NP_172883.2 DREG-2 45..234 CDD:274056 55/229 (24%)
HAD_like <137..254 CDD:304363 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1119971at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128559
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.