DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and AT1G14310

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_172883.2 Gene:AT1G14310 / 837992 AraportID:AT1G14310 Length:254 Species:Arabidopsis thaliana


Alignment Length:251 Identity:61/251 - (24%)
Similarity:100/251 - (39%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFK----ANWYKMNRDYPNFGRDTNPQ 70
            :..|...||||......:.|..:|..:|.:....|:.:.||    |.|.:..| |...||     
plant    45 LLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKEGFKRVFSAPWPEKLR-YQGDGR----- 103

  Fly    71 MEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEK 135
                .:|:.:::   ..:|.:..|     :...:.:.|.....|....|:.|.:..    ||...
plant   104 ----PFWKLVVS---EATGCSDND-----YFEDVYQYYANGEAWHLPEGAYETMSL----LKDAG 152

  Fly   136 CKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHI 200
            .|:.|::|||.||..||::..:....|..|.|.||..||||.:||:.|:|:.   ::.....:|:
plant   153 VKMAVVSNFDTRLRKLLKDLNVIDMFDAVIVSAEVGYEKPDERIFKSALEQI---SVDVNRAVHV 214

  Fly   201 GDGPTTDYLAAKELG---WHSALVHEKSYAYLVKKYGEDIDRDHVFPSLYDFHKKI 253
            ||....|...|..:|   |               .:|||:.      :..|..|:|
plant   215 GDDEGADKGGANAIGIACW---------------LWGEDVQ------TFSDIQKRI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 55/216 (25%)
HAD_like 76..215 CDD:304363 36/138 (26%)
AT1G14310NP_172883.2 DREG-2 45..234 CDD:274056 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3574
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102573
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.