| Sequence 1: | NP_612043.1 | Gene: | Reg-2 / 38075 | FlyBaseID: | FBgn0016715 | Length: | 260 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_172883.2 | Gene: | AT1G14310 / 837992 | AraportID: | AT1G14310 | Length: | 254 | Species: | Arabidopsis thaliana |
| Alignment Length: | 251 | Identity: | 61/251 - (24%) |
|---|---|---|---|
| Similarity: | 100/251 - (39%) | Gaps: | 53/251 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 ITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFK----ANWYKMNRDYPNFGRDTNPQ 70
Fly 71 MEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEK 135
Fly 136 CKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHI 200
Fly 201 GDGPTTDYLAAKELG---WHSALVHEKSYAYLVKKYGEDIDRDHVFPSLYDFHKKI 253 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Reg-2 | NP_612043.1 | DREG-2 | 8..220 | CDD:274056 | 55/216 (25%) |
| HAD_like | 76..215 | CDD:304363 | 36/138 (26%) | ||
| AT1G14310 | NP_172883.2 | DREG-2 | 45..234 | CDD:274056 | 55/228 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 1 | 1.000 | 66 | 1.000 | Domainoid score | I3574 |
| eggNOG | 1 | 0.900 | - | - | E1_COG1011 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1119971at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002375 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_102573 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X2471 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 7.720 | |||||