DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and AT5G44730

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_199286.1 Gene:AT5G44730 AraportID:AT5G44730 Length:255 Species:Arabidopsis thaliana

Alignment Length:225 Identity:67/226 (30%)
Similarity:107/226 (47%) Gaps:18/226 (8%)


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARC-DNNELAKNFKANWYKMNRDYPNFGRDT 67
            ||:.|.||.|||.||:.::...|..|.......|..| |...:.:.||..:..|.:.||.||  .
plant     6 LSKLRCITVDVTGTLIAYKGELGDYYCMAAKAIGLPCPDYKRVHEGFKLAYTDMAQKYPCFG--F 68

  Fly    68 NPQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELK 132
            :.:|....||:..:..:|.::|....:|........:...:.::..:.....|...|:..|:   
plant    69 HAKMPNIVWWKTCVRDSFVKAGYEYDEETFEKIFRRIYSTFGSAAPYSVFQDSQPFLRWARR--- 130

  Fly   133 PEKCKLGVIANFDPR-----LPTL-LQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKN 191
             :...:|:::|.:.|     ||:. |...:    .||.:.|.....|||||:||..|:|::| .|
plant   131 -KGLIVGLVSNAEYRYQEVILPSFGLSKAE----WDFGVFSGIEGIEKPDPRIFTLALERAG-NN 189

  Fly   192 LKPEECLHIGDGPTTDYLAAKELGWHSALV 221
            :.|||.|||||....||:.||.:|.|:.||
plant   190 IAPEEVLHIGDSMRKDYVPAKSIGMHALLV 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 63/219 (29%)
HAD_like 76..215 CDD:304363 40/145 (28%)
AT5G44730NP_199286.1 DREG-2 10..218 CDD:274056 63/219 (29%)
HAD-SF-IA-v1 <91..213 CDD:273686 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2181
OMA 1 1.010
OrthoDB 1 1.010 D1119971at2759
OrthoInspector 1 1.000 T125201
orthoMCL 1 0.900 OOG5_128559
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
76.880

Return to query results.
Submit another query.