DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and AT5G44730

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_199286.1 Gene:AT5G44730 / 834502 AraportID:AT5G44730 Length:255 Species:Arabidopsis thaliana


Alignment Length:225 Identity:67/225 - (29%)
Similarity:107/225 - (47%) Gaps:18/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARC-DNNELAKNFKANWYKMNRDYPNFGRDT 67
            ||:.|.||.|||.||:.::...|..|.......|..| |...:.:.||..:..|.:.||.||  .
plant     6 LSKLRCITVDVTGTLIAYKGELGDYYCMAAKAIGLPCPDYKRVHEGFKLAYTDMAQKYPCFG--F 68

  Fly    68 NPQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELK 132
            :.:|....||:..:..:|.::|....:|........:...:.::..:.....|...|:..|:   
plant    69 HAKMPNIVWWKTCVRDSFVKAGYEYDEETFEKIFRRIYSTFGSAAPYSVFQDSQPFLRWARR--- 130

  Fly   133 PEKCKLGVIANFDPR-----LPTL-LQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKN 191
             :...:|:::|.:.|     ||:. |...:    .||.:.|.....|||||:||..|:|::| .|
plant   131 -KGLIVGLVSNAEYRYQEVILPSFGLSKAE----WDFGVFSGIEGIEKPDPRIFTLALERAG-NN 189

  Fly   192 LKPEECLHIGDGPTTDYLAAKELGWHSALV 221
            :.|||.|||||....||:.||.:|.|:.||
plant   190 IAPEEVLHIGDSMRKDYVPAKSIGMHALLV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 63/218 (29%)
HAD_like 76..215 CDD:304363 40/144 (28%)
AT5G44730NP_199286.1 DREG-2 10..218 CDD:274056 63/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2248
OMA 1 1.010 - - QHG55252
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - otm2945
orthoMCL 1 0.900 - - OOG6_102573
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.