DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and hdhd3

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001072693.1 Gene:hdhd3 XenbaseID:XB-GENE-969463 Length:189 Species:Xenopus tropicalis

Alignment Length:146 Identity:46/147 (31%)
Similarity:71/147 (48%) Gaps:17/147 (12%)


  Fly     8 RLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQME 72
            ||||:|:.:|||:.|...|:||.......|...|...|..:|:..:...:|.:||:|....  |:
 Frog     4 RLITWDIKDTLLRVRVPVGQQYFAEAKRQGLCMDPGSLETSFRNAYRTHSRLFPNYGLAQG--MD 66

  Fly    73 WQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEKC- 136
            .:|||..::..||..|||. .||.:.:.:..|.:.:.|:..|....|:.|.|         :.| 
 Frog    67 SRQWWLDVVLQTFRLSGAE-DDETVRSVAQQLYQDFSTARNWAVVPGAREAL---------DSCK 121

  Fly   137 ----KLGVIANFDPRL 148
                |:.||:|||.||
 Frog   122 GLGLKMAVISNFDRRL 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 46/147 (31%)
HAD_like 76..215 CDD:304363 24/79 (30%)
hdhd3NP_001072693.1 DREG-2 4..>139 CDD:274056 46/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C151406
eggNOG 1 0.900 E1_COG1011
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I4937
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1119971at2759
OrthoFinder 1 1.000 FOG0003230
OrthoInspector 1 1.000 T129268
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.760

Return to query results.
Submit another query.