DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and Hdhd3

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001102981.1 Gene:Hdhd3 RGDID:1585262 Length:251 Species:Rattus norvegicus

Alignment Length:242 Identity:69/243 (28%)
Similarity:121/243 (50%) Gaps:14/243 (6%)


  Fly     6 RFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQ 70
            :.||:|:||.:||::.|...|::|.......|...:...:.:.|:..:...:..:||:|....  
  Rat     6 QMRLLTWDVKDTLIKVRRPVGEEYASKARAHGVLVEATAVEQAFRQAFRAQSHSFPNYGLSLG-- 68

  Fly    71 MEWQQWWRKLIAGTFAESGAAIPD-EKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPE 134
            :..:|||..::..||..:|  :|| :.:...::.|.|.:.:...|:...|:...|:..||    .
  Rat    69 LTSRQWWMDVVLHTFRLAG--VPDAQAMAPVADQLYEDFSSPFAWRVLEGAETTLKGCRK----R 127

  Fly   135 KCKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLH 199
            ..||.|::|||.||..:|....|.::.||.:.|..|...||||:||::|::   |..::|....|
  Rat   128 GMKLAVVSNFDRRLEDILTGLGLREHFDFVLTSEAVGCPKPDPRIFREALQ---LACVEPSAAAH 189

  Fly   200 IGDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYGEDIDRDHVFPSL 246
            :||....||..|:.:|.||.||  .....|.....:.:.::|:.|||
  Rat   190 VGDSYRCDYQGARAVGMHSFLV--VGAEPLDSSVRDAVPKEHILPSL 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 62/213 (29%)
HAD_like 76..215 CDD:304363 43/140 (31%)
Hdhd3NP_001102981.1 DREG-2 8..210 CDD:274056 62/213 (29%)
HAD_like 102..211 CDD:119389 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131224012
eggNOG 1 0.900 E1_COG1011
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1119971at2759
OrthoFinder 1 1.000 FOG0003230
OrthoInspector 1 1.000 T618392
orthoMCL 1 0.900 OOG5_128559
Panther 1 1.100 LDO PTHR46191
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.710

Return to query results.
Submit another query.