DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and Ephx2

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_075225.1 Gene:Ephx2 RGDID:620732 Length:554 Species:Rattus norvegicus

Alignment Length:145 Identity:38/146 (26%)
Similarity:69/146 (47%) Gaps:20/146 (14%)


  Fly    89 GAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKELKPEKCKLGVIAN-----FDPRL 148
            ||::|:    |||  :.|::..::..:..|   ..:.|....||.:.....::.|     .|.|.
  Rat    79 GASLPE----NFS--ISEIFSQAMAARSIN---RPMLQAAAALKKKGFTTCIVTNNWLDDSDKRD 134

  Fly   149 PTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHIGD-GPTTDYLAAK 212
            .......:|.|:.||.|.|.:|...||:|||::..::.  || .||.|.:.:.| |  ::...|:
  Rat   135 ILAQMMCELSQHFDFLIESCQVGMIKPEPQIYKFVLDT--LK-AKPNEVVFLDDFG--SNLKPAR 194

  Fly   213 ELGWHSALVHEKSYA 227
            ::|..:.||.:.:.|
  Rat   195 DMGMVTILVRDTASA 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 35/137 (26%)
HAD_like 76..215 CDD:304363 34/132 (26%)
Ephx2NP_075225.1 Phosphatase 1..224 38/146 (26%)
HAD-SF-IA-v3 5..203 CDD:273662 36/138 (26%)
Phosphate binding. {ECO:0000250|UniProtKB:P34913} 123..124 0/1 (0%)
HAD_like <142..205 CDD:304363 23/68 (34%)
Epoxide hydrolase 233..554
Abhydrolase 239..>379 CDD:304388
Abhydrolase_1 257..530 CDD:278959
Microbody targeting signal. {ECO:0000255} 552..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.