DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and ephx2

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001006912.1 Gene:ephx2 XenbaseID:XB-GENE-947544 Length:560 Species:Xenopus tropicalis

Alignment Length:235 Identity:58/236 (25%)
Similarity:90/236 (38%) Gaps:44/236 (19%)


  Fly     8 RLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQME 72
            |.:.||:...||    |||.|     ..|.....:..|...|..|.:..:.....|.|....|:.
 Frog     5 RFVLFDLGGVLL----TPGPQ-----VAFQRLERSLSLPSGFLQNVFVRSGSEGPFARAERGQIP 60

  Fly    73 WQQWWRKLIA------GTFA-ESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKE 130
            :.    |.||      ..|| |||.::||    :||     |.:|........|..:.:.:....
 Frog    61 FS----KFIAEMDKECKAFAEESGVSLPD----SFS-----LEQTFHGMFESGGINKPMLKAAVT 112

  Fly   131 LKPEKCKLGVIAN-----FDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLK 190
            |:....|..|:.|     ...|..:....:.|:::.|..:.|......||:.||:..|     ||
 Frog   113 LRHHGFKTCVLTNNWIDDSPQRSHSAELFSSLNRHFDLVVESCRTGMRKPETQIYDYA-----LK 172

  Fly   191 NLK--PEECLHIGD-GPTTDYLAAKELGWHSALVHEKSYA 227
            .||  |:|.:.:.| |  .:...|:|:|..:.||.:...|
 Frog   173 MLKANPKETIFLDDIG--ANLKPAREMGIATVLVKDTETA 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 55/227 (24%)
HAD_like 76..215 CDD:304363 38/154 (25%)
ephx2NP_001006912.1 HAD_sEH-N_like 5..215 CDD:319790 58/236 (25%)
Abhydrolase_1 260..537 CDD:306935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.