DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and Nanp

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001009409.1 Gene:Nanp RGDID:1306009 Length:248 Species:Rattus norvegicus

Alignment Length:243 Identity:53/244 (22%)
Similarity:93/244 (38%) Gaps:54/244 (22%)


  Fly     4 LSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGAR----------CDNNELAKNFKANWYKMNR 58
            |||.|.:.||:.|||:.......:...|:..|..::          ||..::         |:::
  Rat     3 LSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEVICDKVQV---------KLSK 58

  Fly    59 D----YPNFGRDTNPQMEWQQWWRKLIAGTFAESGAAIPDEKLHNFSNHLIELYK-TSICWQPCN 118
            :    |.....|.... .|::        ...|:.....:.||   :.....|:| |.:......
  Rat    59 ECFHPYSTCITDVRTS-HWEE--------AIQETKGGADNRKL---AEECYFLWKSTRLQHMTLE 111

  Fly   119 GSVE-LLQQLRKELKPEKCKLGVIANFDPRLPTLLQNTKLD-----QYLDFAINSYEVQAEKPDP 177
            ..|: :|.:||||:     :|.::.|.|.:    .|..|::     .|.|..:...|.:.|||.|
  Rat   112 EDVKAMLTELRKEV-----RLLLLTNGDRQ----TQREKIEACACQSYFDAIVVGGEQKEEKPAP 167

  Fly   178 QIFQKAMEKSGLKNLKPEECLHIGDGPTTDYLAAKELGWHSALVHEKS 225
            .||....:   |..::|.:|:.:||...||.......|..:.:...||
  Rat   168 SIFYHCCD---LLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKS 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 48/233 (21%)
HAD_like 76..215 CDD:304363 33/146 (23%)
NanpNP_001009409.1 CTE7 6..234 CDD:274057 50/241 (21%)
Substrate binding. {ECO:0000250} 12..14 1/2 (50%)
HAD_like <114..239 CDD:304363 30/112 (27%)
Substrate binding. {ECO:0000250} 131..132 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.