DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Reg-2 and EPHX2

Sequence 1:NP_612043.1 Gene:Reg-2 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 HGNCID:3402 Length:555 Species:Homo sapiens

Alignment Length:96 Identity:29/97 (30%)
Similarity:41/97 (42%) Gaps:26/97 (27%)


  Fly   151 LLQNTKLD----------------QYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLK--PEEC 197
            :|.||.||                .:.||.|.|.:|...||:|||:     |..|..||  |.|.
Human   121 ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIY-----KFLLDTLKASPSEV 180

  Fly   198 LHIGD-GPTTDYLAAKELGWHSALVHEKSYA 227
            :.:.| |  .:...|::||..:.||.:...|
Human   181 VFLDDIG--ANLKPARDLGMVTILVQDTDTA 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 26/88 (30%)
HAD_like 76..215 CDD:304363 25/83 (30%)
EPHX2NP_001970.2 Phosphatase 1..224 29/97 (30%)
HAD_sEH-N_like 3..214 CDD:319790 29/97 (30%)
Phosphate binding. {ECO:0000269|PubMed:15096040} 123..124 0/1 (0%)
Epoxide hydrolase 235..555
Abhydrolase_1 259..531 CDD:306935
Microbody targeting signal. {ECO:0000255} 553..555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.