DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Reg-2 and acds-10

DIOPT Version :9

Sequence 1:	NP_612043.1	Gene:	Reg-2 / 38075	FlyBaseID:	FBgn0016715	Length:	260	Species:	Drosophila melanogaster
Sequence 2:	NP_504508.1	Gene:	acds-10 / 178962	WormBaseID:	WBGene00019599	Length:	985	Species:	Caenorhabditis elegans

Alignment Length:	142	Identity:	32/142 - (22%)
Similarity:	60/142 - (42%)	Gaps:	43/142 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    97 LHNFSNHLI------------ELYKTSICWQPCNGSVELLQQLR----------KELKPEKCKLG 139
            ::||.|:.:            ::..|.:..:    .|||::.||          .....::.:|
Worm    69 IYNFQNNRVGDILPIFVEVSSQIQHTPLLPE----MVELIKSLRLAGYRTILITNNFYTDRARL- 128

  Fly   140 VIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHIGD-G 203
                    |||:.....|  ..|..:.|..:...|||.:|::.|:|:|   .|.|.:|:.:.| |
Worm   129 --------LPTVPSQVGL--LFDDVLESCRLGLRKPDTKIYELALERS---KLHPSDCVFLDDLG 180

  Fly   204 PTTDYLAAKELG 215
              ::..:|||:|
Worm   181 --SNLKSAKEMG 190

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Reg-2	NP_612043.1	DREG-2	8..220	CDD:274056	32/142 (23%)
Reg-2	NP_612043.1	HAD_like	76..215	CDD:304363	31/140 (22%)
acds-10	NP_504508.1	HAD-1A3-hyp	2..212	CDD:274054	32/142 (23%)
		HAD_like	<96..200	CDD:304363	28/115 (24%)
		PLN02876	250..982	CDD:215473
		ACAD10_11_N-like	250..503	CDD:270703
		ACAD_FadE2	585..982	CDD:173844
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1011
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810