DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and acds-10

DIOPT Version :9

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_504508.1 Gene:acds-10 / 178962 WormBaseID:WBGene00019599 Length:985 Species:Caenorhabditis elegans


Alignment Length:142 Identity:32/142 - (22%)
Similarity:60/142 - (42%) Gaps:43/142 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LHNFSNHLI------------ELYKTSICWQPCNGSVELLQQLR----------KELKPEKCKLG 139
            ::||.|:.:            ::..|.:..:    .|||::.||          .....::.:| 
 Worm    69 IYNFQNNRVGDILPIFVEVSSQIQHTPLLPE----MVELIKSLRLAGYRTILITNNFYTDRARL- 128

  Fly   140 VIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHIGD-G 203
                    |||:.....|  ..|..:.|..:...|||.:|::.|:|:|   .|.|.:|:.:.| |
 Worm   129 --------LPTVPSQVGL--LFDDVLESCRLGLRKPDTKIYELALERS---KLHPSDCVFLDDLG 180

  Fly   204 PTTDYLAAKELG 215
              ::..:|||:|
 Worm   181 --SNLKSAKEMG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 32/142 (23%)
HAD_like 76..215 CDD:304363 31/140 (22%)
acds-10NP_504508.1 HAD-1A3-hyp 2..212 CDD:274054 32/142 (23%)
HAD_like <96..200 CDD:304363 28/115 (24%)
PLN02876 250..982 CDD:215473
ACAD10_11_N-like 250..503 CDD:270703
ACAD_FadE2 585..982 CDD:173844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.