DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg-2 and acad10

DIOPT Version :8

Sequence 1:NP_612043.1 Gene:Reg-2 / 38075 FlyBaseID:FBgn0016715 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_004910566.1 Gene:acad10 / 100036613 XenbaseID:XB-GENE-967980 Length:1059 Species:Xenopus tropicalis

Alignment Length:244 Identity:51/245 (21%)
Similarity:97/245 (40%) Gaps:62/245 (25%)


  Fly    42 NNELAKNFKA-----------NWYKMNRDYP--------------NFGRDTNPQMEWQQWWR-KL 80
            |:.::|.:||           :.|:|.:::.              ..|..:.|   |.::.| :|
 Frog    35 NHTVSKGYKAVIFDMGGVLLPSPYRMIKEWEICNKVPSGTLKQAIRTGGHSGP---WMKFMRGEL 96

  Fly    81 IAGTFAESGAAIPDEKLHNFSNHLIELYK--TSICWQPCNGSVELLQQLRKELKPEKCKLGVIAN 143
            .|..|.|...    |:..|.:...:.:::  |.....|.......:.|..:.::.|..|:.|::|
 Frog    97 TAELFVEHFG----EQCSNIAGSPVPIFRFLTDFTSGPMIEQHSCMTQAIQCIRSEGLKIAVLSN 157

  Fly   144 ------FDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHIGD 202
                  .:..||  |..::.|..::..|..    ..||.|||:|..:|:.|   ::|.:.:.: |
 Frog   158 NFFLHSGESFLP--LNRSQFDVIVESCIEG----VCKPSPQIYQLCVERLG---VQPRDSIFL-D 212

  Fly   203 GPTTDYLAAKELGWHSALVHE--KSYAYLVKKYGEDIDRDHVFPSLYDF 249
            ....:..||.:||:.:..|.:  :|...|.|:.|.         ||.||
 Frog   213 DLEQNVRAAAQLGFSTIKVDDPRESLEQLEKQLGF---------SLKDF 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Reg-2NP_612043.1 DREG-2 8..220 CDD:274056 42/212 (20%)
HAD_like 76..215 CDD:304363 32/148 (22%)
acad10XP_004910566.1 HAD-1A3-hyp 42..247 CDD:274054 45/222 (20%)
HAD_like 46..235 CDD:304363 39/206 (19%)
PLN02876 257..1058 CDD:215473
ACAD10_11_N-like 286..536 CDD:270703
ACAD 665..1058 CDD:299127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.