DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and Borcs6

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_082281.2 Gene:Borcs6 MGIID:1919173 Length:360 Species:Mus musculus

Alignment Length:337 Identity:82/338 (24%)
Similarity:148/338 (44%) Gaps:69/338 (20%)


  Fly     1 MSHRHQDIPIRPRYGYVAE-------ESGPSEGAARSSGSG--ATPASSYTEIPFLAQYPGAVPE 56
            :|.||.....:...|.:|.       |..||..|..|...|  ..|.|.:...| .:.||  .||
Mouse    53 VSSRHPRASPKTWSGSIAHGPELDTWEDKPSSRATPSGARGRRGVPGSEHAPPP-SSWYP--EPE 114

  Fly    57 HVLQDLTPTATGHAAIPGSTKTRPNGEKYLNLD----SGEDPDEEDD-----------PLEEEDN 106
                   |:....:|:....:..|.|.: :|::    .|:|.|:||:           |...:|:
Mouse   115 -------PSEDQPSALRVCRRGSPGGVE-MNVELPQQEGDDDDDEDEEAAAGRAGRSFPSRLQDS 171

  Fly   107 -------------SNSNSNSKGSSGDIERHRLKAESTVPYELDGETSDSDGMRHFVAHDLEAKLR 158
                         .:|:|...|:.|.     .:|..:.|.||:|..|....:.||||::|:.|:|
Mouse   172 RSLDGLSGACGGGGSSSSGETGAGGG-----RRATISSPLELEGTVSRHGDLTHFVANNLQLKIR 231

  Fly   159 ERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDN 223
            ...|..........|..:..|                :..||.:|..||.|:|..::.|...||.
Mouse   232 LSGAPPPVPPASVRPCLTPAP----------------TPTIPPIDPDVLRDLERLSRELGGRVDR 280

  Fly   224 LMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRI 288
            |:..||..:..:::::...::.:|:||:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::
Mouse   281 LLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQV 345

  Fly   289 RQIKRLVDMLDS 300
            |.|:|.:::|::
Mouse   346 RDIRRTLEVLEA 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 42/160 (26%)
Borcs6NP_082281.2 DUF2365 215..358 CDD:287166 42/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177636153
eggNOG 1 0.900 E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5063
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 1 1.000 T1085396
orthoMCL 1 0.900 OOG5_133405
Panther 1 1.100 LDO PTHR13440
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4339
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.