DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and si:dkey-72l14.4

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001038453.1 Gene:si:dkey-72l14.4 ZFINID:ZDB-GENE-060531-151 Length:435 Species:Danio rerio

Alignment Length:296 Identity:77/297 (26%)
Similarity:134/297 (45%) Gaps:31/297 (10%)


  Fly    12 PRYGYVAEESGPSEGAARSSGSGATPASSYTEIPFLAQYP---GAVPEHVLQDLTPT-ATGHAAI 72
            |.:..:.|.|.|:........:..:|    .|.|.|...|   .|.|..:|.||..: ...|...
Zfish   161 PTHSEIEEWSNPNSVDEFQPNTSISP----DEAPPLVPAPPPDQATPPPLLPDLDDSPCPAHVMA 221

  Fly    73 PGSTKTRPNGEKYLNLDSGEDPDEEDDPLEEEDNSNSNSNSKGS---SGDIERHRLKAESTVPYE 134
            ....::.|..|:.:.       ..:|....:|.:......::|.   .|..|..|....|.:  |
Zfish   222 EVRVRSVPERERVVR-------GMQDSKSLDEISGACGGGTRGGGARGGQAEGRRATISSAL--E 277

  Fly   135 LDGETSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNI 199
            |:|..|....:.||:..:||.|::.....|.     .|.....|||  |.|.|.|.|    ..:|
Zfish   278 LEGTVSHDGDLTHFITKNLEQKIKMSSRPSL-----DTDSDCSGPI--TRGRGSLRR----PADI 331

  Fly   200 PEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQ 264
            |.:|.|||.|:....|.:|.||:.::.:|...:.::::::...::.:|::|:.|.:::|.:||..
Zfish   332 PPIDPSVLVDLHKHTQDVAQSVELMLRSLNGTIQNMTALSVGYIQTYRDSVDSLGESVDMSIKGM 396

  Fly   265 YQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            |.|:|:.||:.:||:|...|..:||.|||.:|.|::
Zfish   397 YTLMARCEELDRSMQPIHTLAAQIRDIKRTLDALET 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 49/160 (31%)
si:dkey-72l14.4NP_001038453.1 DUF2365 285..433 CDD:287166 49/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177635451
eggNOG 1 0.900 E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5013
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 1 1.000 T1054539
orthoMCL 1 0.900 OOG5_133405
Panther 1 1.100 LDO PTHR13440
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4339
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.