DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and BORCS6

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_060092.2 Gene:BORCS6 HGNCID:25939 Length:357 Species:Homo sapiens

Alignment Length:328 Identity:82/329 (25%)
Similarity:141/329 (43%) Gaps:83/329 (25%)


  Fly    11 RPRYGYVAEESGPSEGAARSSGS--GATPASSYTEIPFLAQYPGAVPEHVLQDLTPTATGHAAIP 73
            ||....:..|.|| :|....:||  ||               |||  ||     .|:.:.....|
Human    72 RPEREALENEPGP-QGTLSGAGSRRGA---------------PGA--EH-----EPSLSSRHKNP 113

  Fly    74 GSTKTRPNGEKYLNLDSGED-------------PDEEDDPLEE---------------EDNSNSN 110
            ...:.:|:        ||.|             ..||:|..||               :|:.:.:
Human   114 APPEGKPS--------SGRDCRRGGPGGGMDVEQQEEEDNDEEAAAGSRAGRSFSSRLQDSRSLD 170

  Fly   111 SNSK-----GSSGDIERHR---LKAESTVPYELDGETSDSDGMRHFVAHDLEAKLRERVAASAYS 167
            ..|:     ||||..|...   .:|..:.|.||:|..|....:.||||::|:.|:|...|.....
Human   171 GLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPPPPP 235

  Fly   168 SEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLL 232
            |....|..:..|....:              ||.:|..||.|:|..::.|...||.|:..||..:
Human   236 SAPARPCPAPAPTPTPA--------------IPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAV 286

  Fly   233 HSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDM 297
            ..:::::...::.:|:||:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::|.|:|.:::
Human   287 QELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEV 351

  Fly   298 LDS 300
            |::
Human   352 LEA 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 43/160 (27%)
BORCS6NP_060092.2 DUF2365 210..355 CDD:287166 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177639524
eggNOG 1 0.900 E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5028
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 1 1.000 T1075289
orthoMCL 1 0.900 OOG5_133405
Panther 1 1.100 LDO PTHR13440
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4339
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.