DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and Borcs6

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001017474.2 Gene:Borcs6 RGDID:1563885 Length:360 Species:Rattus norvegicus

Alignment Length:311 Identity:83/312 (27%)
Similarity:145/312 (46%) Gaps:62/312 (20%)


  Fly    20 ESGPSEGAARSS--GSGATPASSYTEIPFLAQYPGAVPEHVLQDLTPTATGHAAIPGSTKTRPNG 82
            |..||..|..|.  ||..|..|.:|..| .:.||  .||       |:....:|:....:..|.|
  Rat    79 EDKPSARATPSGARGSRGTSGSEHTPPP-SSWYP--EPE-------PSEDQPSALTVCRRGSPGG 133

  Fly    83 EKYLNLD----SGEDPDEEDD-----------PLEEEDN-------------SNSNSNSKGSSGD 119
            .: :|::    .|:|.|:.||           |...:|:             .:|:|...|:.|.
  Rat   134 VE-MNVELPQQEGDDDDDGDDEEAADRAGHSFPSRLQDSRSLDGLSGACGGGGSSSSGEAGAGGG 197

  Fly   120 IERHRLKAESTVPYELDGETSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATS 184
                 .:|..:.|.||:|..|....:.||||::|:.|:|...|.|              |:...|
  Rat   198 -----RRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPS--------------PVPPAS 243

  Fly   185 GNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNA 249
            |...||.  ..:..||.:|..||.|:|..::.|...||.|:..||..:..:::::...::.:|:|
  Rat   244 GRPCLTP--APTPTIPPIDPDVLRDLERLSRELGGRVDRLLCGLGGAVQELTALSVGCIQTYRDA 306

  Fly   250 VNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            |:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::|.|:|.:::|::
  Rat   307 VDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEA 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 46/160 (29%)
Borcs6NP_001017474.2 DUF2365 215..358 CDD:287166 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177637634
eggNOG 1 0.900 E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 1 1.000 T1088942
orthoMCL 1 0.900 OOG5_133405
Panther 1 1.100 LDO PTHR13440
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.