| Sequence 1: | NP_001261214.1 | Gene: | BORCS6 / 38068 | FlyBaseID: | FBgn0035140 | Length: | 302 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017474.2 | Gene: | Borcs6 / 497934 | RGDID: | 1563885 | Length: | 360 | Species: | Rattus norvegicus | 
| Alignment Length: | 311 | Identity: | 83/311 - (26%) | 
|---|---|---|---|
| Similarity: | 145/311 - (46%) | Gaps: | 62/311 - (19%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    20 ESGPSEGAARSS--GSGATPASSYTEIPFLAQYPGAVPEHVLQDLTPTATGHAAIPGSTKTRPNG 82 
  Fly    83 EKYLNLD----SGEDPDEEDD-----------PLEEEDN-------------SNSNSNSKGSSGD 119 
  Fly   120 IERHRLKAESTVPYELDGETSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATS 184 
  Fly   185 GNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNA 249 
  Fly   250 VNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| BORCS6 | NP_001261214.1 | DUF2365 | 142..301 | CDD:287166 | 46/159 (29%) | 
| Borcs6 | NP_001017474.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..201 | 31/137 (23%) | |
| DUF2365 | 215..358 | CDD:287166 | 46/159 (29%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166352451 | |
| Domainoid | 1 | 1.000 | 82 | 1.000 | Domainoid score | I8259 | 
| eggNOG | 1 | 0.900 | - | - | E1_KOG4514 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 94 | 1.000 | Inparanoid score | I4980 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0006641 | |
| OrthoInspector | 1 | 1.000 | - | - | oto97508 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_106297 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR13440 | 
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 9 | 8.790 | |||||