DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and blos-7

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_500377.1 Gene:blos-7 WormBaseID:WBGene00021376 Length:157 Species:Caenorhabditis elegans

Alignment Length:159 Identity:42/160 (26%)
Similarity:85/160 (53%) Gaps:27/160 (17%)


  Fly   142 SDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSV 206
            |:....||..|||.::||       |:..::|..:     |.:|             :|  |..:
 Worm    19 SNKQTSFVVDDLEERIRE-------SARISSPKRA-----AAAG-------------LP--DPKI 56

  Fly   207 LSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKA 271
            |.|:|...:.:.:::|.::.::...||.:|.:|.::::.:.:.|.|..|..|||:|..|.:|||.
 Worm    57 LVDLETHTKEIVNNMDTMLRDMRGSLHGMSDLTLESLQCYNSGVEKACDEADANVKSTYAMLAKV 121

  Fly   272 EEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            ||:.:||...::|..:|::::|||::.::
 Worm   122 EEVNQSMGNVQKLAGQIKEMRRLVELFET 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 42/160 (26%)
blos-7NP_500377.1 DUF2365 22..151 CDD:287166 41/157 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177266325
eggNOG 1 0.900 E1_KOG4514
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 1 1.000 T474451
orthoMCL 1 0.900 OOG5_133405
Panther 1 1.100 LDO PTHR13440
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4339
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.