DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS6 and blos-7

DIOPT Version :9

Sequence 1:NP_001261214.1 Gene:BORCS6 / 38068 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_500377.1 Gene:blos-7 / 177119 WormBaseID:WBGene00021376 Length:157 Species:Caenorhabditis elegans


Alignment Length:159 Identity:42/159 - (26%)
Similarity:85/159 - (53%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSV 206
            |:....||..|||.::||       |:..::|..:     |.:|             :|  |..:
 Worm    19 SNKQTSFVVDDLEERIRE-------SARISSPKRA-----AAAG-------------LP--DPKI 56

  Fly   207 LSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKA 271
            |.|:|...:.:.:::|.::.::...||.:|.:|.::::.:.:.|.|..|..|||:|..|.:|||.
 Worm    57 LVDLETHTKEIVNNMDTMLRDMRGSLHGMSDLTLESLQCYNSGVEKACDEADANVKSTYAMLAKV 121

  Fly   272 EEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            ||:.:||...::|..:|::::|||::.::
 Worm   122 EEVNQSMGNVQKLAGQIKEMRRLVELFET 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS6NP_001261214.1 DUF2365 142..301 CDD:287166 42/159 (26%)
blos-7NP_500377.1 DUF2365 22..151 CDD:287166 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166111
Domainoid 1 1.000 72 1.000 Domainoid score I6101
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006641
OrthoInspector 1 1.000 - - oto18207
orthoMCL 1 0.900 - - OOG6_106297
Panther 1 1.100 - - LDO PTHR13440
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.