DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17180 and borcs6

Sequence 1:NP_001261214.1 Gene:CG17180 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_002941977.1 Gene:borcs6 XenbaseID:XB-GENE-6045473 Length:154 Species:Xenopus tropicalis

Alignment Length:169 Identity:47/170 (28%)
Similarity:93/170 (55%) Gaps:21/170 (12%)


  Fly   135 LDGE-TSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQ--S 196
            :||. |....|.|....|.:.|.:|.        ::||          :...|.::.|..||  .
 Frog     1 MDGAGTVGKGGSRDHQKHSVGAPVRH--------TQHT----------SEKANSIVRRHTLQRSK 47

  Fly   197 RNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANI 261
            .:||.:|..||.::|:..|.:|..||.:|::|...:.::::::...::.:|::|:.|.:::|.:|
 Frog    48 ADIPPIDPEVLKELEIHTQDVALKVDQMMKSLNGTIQNMTALSVGYIQTYRDSVDSLGESVDMSI 112

  Fly   262 KCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            |..|.|:|:.||:.:||:|...|.::||:|||.:::.:|
 Frog   113 KGMYTLMARCEELDRSMQPIHTLAKQIREIKRTLEIFES 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17180NP_001261214.1 DUF2365 142..301 CDD:287166 44/162 (27%)
borcs6XP_002941977.1 DUF2365 21..152 CDD:287166 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006151
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.