DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and ZMAT1

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005262269.2 Gene:ZMAT1 HGNCID:29377 Length:718 Species:Homo sapiens

Alignment Length:245 Identity:60/246 (24%)
Similarity:101/246 (41%) Gaps:65/246 (26%)


  Fly    69 CMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAW 133
            |:.||::....:.|      |.:.::.        ||:|.|.:....:...|||.:.|.:::|.:
Human    94 CLREDAIWNEQEKA------ELFTDKF--------CQVCGVMLQFESQRISHYEGEKHAQNVSFY 144

  Fly   134 LAKNYTEVGLEAPPVK------RLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKH-KRVEQ 191
            ...:..:..:....:|      ::.:......|.| |:|||:..:|.:.|:.||:|:.| |:::|
Human   145 FQMHGEQNEVPGKKMKMHVENFQVHRYEGVDKNKF-CDLCNMMFSSPLIAQSHYVGKVHAKKLKQ 208

  Fly   192 -----GVAKPSGAR------HCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERT 245
                 ..|.|||.:      ...||.     .|.|.||  |....||..            :.||
Human   209 LMEEHDQASPSGFQPEMAGVPLTTSA-----ESTFLKP--LPVKPPTAF------------SMRT 254

  Fly   246 --CHLCKIVVTSAAQMQAHLAGARHQ----------KNWRTSRQDQNHSE 283
              ||:|.|..||....::|:.|:.||          ||.|.: ||...:|
Human   255 YVCHICSIAFTSLDMFRSHMQGSEHQIKESIVINLVKNSRKT-QDSYQNE 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 12/65 (18%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 11/40 (28%)
ZnF_U1 304..336 CDD:197732
ZMAT1XP_005262269.2 ZnF_U1 175..209 CDD:197732 14/35 (40%)
DUF1764 612..>664 CDD:285744
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89510833
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130269
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.