DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and AT2G19380

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_565450.1 Gene:AT2G19380 AraportID:AT2G19380 Length:613 Species:Arabidopsis thaliana

Alignment Length:196 Identity:43/197 (22%)
Similarity:70/197 (36%) Gaps:38/197 (19%)


  Fly   164 CELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPES-------- 220
            |.|||..:|.......|..|:||:.....||...                 :.|.:|        
plant    87 CSLCNATMTCEQDYFAHVYGKKHQEKANEVADMD-----------------YSKQQSEHPAVDKN 134

  Fly   221 -LTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKN------WRTSRQD 278
             ||:....|:.:.     .|:|....|.||.|..||...:.||..|.:|:..      .:..||.
plant   135 NLTQQPDLDIYVG-----LSNDYPWFCSLCDINATSEQTLLAHANGKKHRVKVERFDAEQQKRQS 194

  Fly   279 QNHSEAPIPETEKLD-AAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKNLSQTE 342
            ..||.....:..|.. ..::.:..:....::|..||:....:..|..|..|:||.:.|:....|:
plant   195 TQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLLSHANGRKHRENVELFDATQ 259

  Fly   343 K 343
            :
plant   260 Q 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371
zf-met 104..126 CDD:289631
zf-met 163..186 CDD:289631 8/22 (36%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 19/90 (21%)
ZnF_U1 304..336 CDD:197732 9/32 (28%)
AT2G19380NP_565450.1 zf-LYAR 30..57 CDD:285943
ZnF_U1 83..116 CDD:197732 9/29 (31%)
ZnF_U1 151..185 CDD:197732 11/34 (32%)
ZnF_U1 221..255 CDD:197732 9/34 (26%)
RRM_SF 408..483 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.947 Consistency score
10.910

Return to query results.
Submit another query.