DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and ZNF385D

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_016862680.1 Gene:ZNF385D / 79750 HGNCID:26191 Length:515 Species:Homo sapiens


Alignment Length:428 Identity:89/428 - (20%)
Similarity:143/428 - (33%) Gaps:144/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PDAEISTSNRLVAP--GKRTDKKDNGSIRTNMKRKAKCMEEDSLKANGDLALFPGRDESYPEELN 96
            |....:.|.|:.:.  |:|  :|..|:.:....|...|:.:...:|.    |.|...|..||...
Human     4 PGRRAAASRRMKSSVGGRR--EKLLGAPKAQPSRDFTCVHDGESEAE----LIPDDFEEKPEREK 62

  Fly    97 RLIGPLNCQLCKVQMTSRKRARDHYESKAHD---RHISAWLAKNYTEVGLEAPPVKRLAKQGPTG 158
            :......|.:|.:|:.|..:|:.||..|:|.   :.:|....||......::|.:..|.:  |..
Human    63 KHTNFTLCNVCNIQLNSAAQAQIHYNGKSHQKRLKQLSNGTLKNDNGGTCQSPALPALVR--PPA 125

  Fly   159 P----------------------NAF------------------------------HCELCNLDL 171
            |                      |.|                              .|.:|.|..
Human   126 PPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQKAVINHTFGVPLPHRRKQIISCNICQLRF 190

  Fly   172 TSSMHARQHYLGRKH----KRVE-------------------------------------QGVAK 195
            .|...|..||.|.||    |.:|                                     :|..|
Human   191 NSDSQAAAHYKGTKHAKKLKALEAMKNKQKSVTAKDSAKTTFTSITTNTINTSSDKTGGKKGAMK 255

  Fly   196 PSG--ARHC--DTSVGRYGIGSL----FRKPESLTKD-------SPTDVLISENSVIKSDDNERT 245
            |.|  ...|  |.:.|...|.:.    .||...:|.:       |||..  :.||...|.:.|..
Human   256 PCGLFLPFCTRDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKSPTTA--TGNSSCPSTETEEE 318

  Fly   246 -------CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHS-------EAPIPETEKLDAAE 296
                   |.|||:.|.||:|::||.:|.:|    :|..:.:|.|       .|.:.....::...
Human   319 KAKRLLYCSLCKVAVNSASQLEAHNSGTKH----KTMLEARNGSGTIKAFPRAGVKGKGPVNKGN 379

  Fly   297 LALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKR 334
            ..|...   .::|:.|::.:|.|:.|:||...::|..|
Human   380 TGLQNK---TFHCEICDVHVNSETQLKQHISSRRHKDR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 18/113 (16%)
zf-met 104..126 CDD:289631 8/21 (38%)
zf-met 163..186 CDD:289631 8/22 (36%)
C2H2 Zn finger 164..186 CDD:275371 8/21 (38%)
UFD2 255..>338 CDD:227443 21/87 (24%)
ZnF_U1 304..336 CDD:197732 9/31 (29%)
ZNF385DXP_016862680.1 C2H2 Zn finger 70..92 CDD:275371 8/21 (38%)
zf-met 70..92 CDD:289631 8/21 (38%)
C2H2 Zn finger 183..205 CDD:275371 8/21 (38%)
zf-met 183..205 CDD:289631 8/21 (38%)
zf-met 325..348 CDD:289631 11/22 (50%)
C2H2 Zn finger 326..348 CDD:275371 11/21 (52%)
zf-met 388..411 CDD:289631 7/22 (32%)
C2H2 Zn finger 389..411 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.