DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and ZMAT4

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_016869325.1 Gene:ZMAT4 / 79698 HGNCID:25844 Length:240 Species:Homo sapiens


Alignment Length:261 Identity:58/261 - (22%)
Similarity:90/261 - (34%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFH----C 164
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|||..:..:..:...    |
Human    16 CKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGC---PAKRLRSENGSDADMVDKNKCC 77

  Fly   165 ELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTD 228
            .|||:..||::.|..||.|:.| ||::..:.:.:..:...|             |.|..|....|
Human    78 TLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTAT-------------PLSPLKPPRMD 129

  Fly   229 VLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLD 293
            ......|..:..|::|.|.||.....:....|.|..|.:|:||                      
Human   130 TAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKN---------------------- 172

  Fly   294 AAELALYR-----TPMGQYYCQPCNMM---------------------MNHESTLQQHFIGKKHL 332
            ||.:||..     ..||:...:.|..|                     :.|.|.|...||.....
Human   173 AARVALLEQLGTTLDMGELRGKACFSMRHLLHNGKMRTVTEDHLWLLIVRHSSRLSLFFIATVET 237

  Fly   333 K 333
            |
Human   238 K 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/58 (24%)
zf-met 104..126 CDD:289631 8/21 (38%)
zf-met 163..186 CDD:289631 10/26 (38%)
C2H2 Zn finger 164..186 CDD:275371 10/21 (48%)
UFD2 255..>338 CDD:227443 20/105 (19%)
ZnF_U1 304..336 CDD:197732 10/51 (20%)
ZMAT4XP_016869325.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5347
Isobase 1 0.950 - 0 Normalized mean entropy S7931
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - otm51493
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5774
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.