DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zgc:171482

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005157109.2 Gene:zgc:171482 ZFINID:ZDB-GENE-080204-84 Length:254 Species:Danio rerio

Alignment Length:304 Identity:79/305 (26%)
Similarity:118/305 (39%) Gaps:71/305 (23%)


  Fly    47 PGKRTDKKDNGSIRTNMKRKAKCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQM 111
            ||.|:        |:|.|.|:        .|.||..||   .|||            |.:|..|:
Zfish    12 PGDRS--------RSNAKMKS--------AAAGDEGLF---TESY------------CNICNAQL 45

  Fly   112 TSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFH--------CELCN 168
            .|..:...|||||.|...:..:...:..:.|   ||.|||.   |..|::..        |.|||
Zfish    46 ISESQRVAHYESKKHANKVRLFYMLHPEDGG---PPSKRLR---PDNPDSAENEVDRNKCCTLCN 104

  Fly   169 LDLTSSMHARQHYLGRKH-KRVEQGVAK-PSGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLI 231
            :..||::.|:.||.|:.| |||...:.: ||.....|::           .|.|.|.:.|..   
Zfish   105 MFFTSAIVAQSHYQGKTHAKRVRLVLGETPSLPTPTDSA-----------PPTSQTTEPPPP--- 155

  Fly   232 SENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAE 296
            :...:..:.:..:.|.||.....:....|.|..|.:|::|...:|..:..:.:       |||.|
Zfish   156 TWQPLANNGEAGKYCCLCGAWFNNPLMAQQHYEGKKHKRNAARARLLEQLAGS-------LDANE 213

  Fly   297 LALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKNLSQ 340
            ....|.   .|.|..||:::|.......|..|.||...:|...|
Zfish   214 STGLRR---SYSCSVCNVVLNSIEQYHAHLQGSKHQNNLKQNQQ 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 18/59 (31%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 10/31 (32%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 21/83 (25%)
ZnF_U1 304..336 CDD:197732 9/32 (28%)
zgc:171482XP_005157109.2 zf-met 37..60 CDD:289631 10/35 (29%)
C2H2 Zn finger 38..60 CDD:275371 9/22 (41%)
ZnF_U1 95..129 CDD:197732 14/34 (41%)
C2H2 Zn finger 100..122 CDD:275371 10/22 (45%)
ZnF_U1 167..198 CDD:197732 8/31 (26%)
C2H2 Zn finger 170..192 CDD:275371 6/22 (27%)
C2H2 Zn finger 223..245 CDD:275371 7/22 (32%)
zf-met 223..245 CDD:289631 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89387211
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5217
OMA 1 1.010
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T128793
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.