Sequence 1: | NP_612032.1 | Gene: | CG1231 / 38060 | FlyBaseID: | FBgn0035134 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001921908.1 | Gene: | znf385c / 793202 | ZFINID: | ZDB-GENE-091112-1 | Length: | 460 | Species: | Danio rerio |
Alignment Length: | 336 | Identity: | 72/336 - (21%) |
---|---|---|---|
Similarity: | 118/336 - (35%) | Gaps: | 115/336 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 LKANGDLALFPGRDESYPEE---LNRLIG---------PLNCQLCKVQMTSRKRARDHYESKAHD 127
Fly 128 RHISAWLAKNYTEVGLEAPPVKRLAKQ--------------------------GPTGPNAF---- 162
Fly 163 -------------------HC---------ELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGA 199
Fly 200 RHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLA 264
Fly 265 GARHQ-----KNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQ 324
Fly 325 HFIGKKHLKRV 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1231 | NP_612032.1 | C2H2 Zn finger | 104..163 | CDD:275371 | 17/107 (16%) |
zf-met | 104..126 | CDD:289631 | 6/21 (29%) | ||
zf-met | 163..186 | CDD:289631 | 8/31 (26%) | ||
C2H2 Zn finger | 164..186 | CDD:275371 | 7/30 (23%) | ||
UFD2 | 255..>338 | CDD:227443 | 22/86 (26%) | ||
ZnF_U1 | 304..336 | CDD:197732 | 10/32 (31%) | ||
znf385c | XP_001921908.1 | ZnF_U1 | 78..105 | CDD:197732 | 8/26 (31%) |
C2H2 Zn finger | 78..100 | CDD:275371 | 6/21 (29%) | ||
ZnF_U1 | 238..263 | CDD:197732 | 10/25 (40%) | ||
C2H2 Zn finger | 240..262 | CDD:275371 | 10/21 (48%) | ||
zf-C2H2_jaz | 304..329 | CDD:288983 | 8/24 (33%) | ||
C2H2 Zn finger | 306..328 | CDD:275371 | 7/21 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582118 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |