DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and znf385c

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_001921908.1 Gene:znf385c / 793202 ZFINID:ZDB-GENE-091112-1 Length:460 Species:Danio rerio


Alignment Length:336 Identity:72/336 - (21%)
Similarity:118/336 - (35%) Gaps:115/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LKANGDLALFPGRDESYPEE---LNRLIG---------PLNCQLCKVQMTSRKRARDHYESKAHD 127
            |..:..|:|||..:...|.:   :|...|         .::|.:|.::..|..:|..||:...|.
Zfish    37 LSGSSPLSLFPNFNNMDPVQKAVINHTFGVPQSLKKKQVISCNICHLRFNSTNQAEAHYKGHKHA 101

  Fly   128 RHISAWLAKNYTEVGLEAPPVKRLAKQ--------------------------GPTGPNAF---- 162
            |.:.|          |||...|:..:|                          .|..|.|.    
Zfish   102 RKLKA----------LEAQKNKQQRRQQDNSHHNREREKDRERDKERERVKASAPDPPPALLDDT 156

  Fly   163 -------------------HC---------ELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGA 199
                               ||         |:.:.||.:|....||         ...:.:||| 
Zfish   157 AIEGTAVSDPESALRVDDAHCSSVVLTPISEVSSADLCASSPHSQH---------PDALLEPSG- 211

  Fly   200 RHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLA 264
               |||            |.  .:|||.....:|....||..:.. |.:||:.|.|:.||:||.:
Zfish   212 ---DTS------------PP--PQDSPAADTPAEKEPKKSKQHLH-CPICKVTVNSSIQMEAHNS 258

  Fly   265 GARHQ-----KNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQ 324
            |.:|:     ::....|:.:..|..|..::::|  |...........:||:.|.:.:|.|:.|.|
Zfish   259 GTKHKLMMDGQSVLPRRRGKAMSSRPSCKSKRL--ASKGSLGVASKSFYCEVCEIHVNSETQLSQ 321

  Fly   325 HFIGKKHLKRV 335
            |...::|..|:
Zfish   322 HMNSRRHKDRL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/107 (16%)
zf-met 104..126 CDD:289631 6/21 (29%)
zf-met 163..186 CDD:289631 8/31 (26%)
C2H2 Zn finger 164..186 CDD:275371 7/30 (23%)
UFD2 255..>338 CDD:227443 22/86 (26%)
ZnF_U1 304..336 CDD:197732 10/32 (31%)
znf385cXP_001921908.1 ZnF_U1 78..105 CDD:197732 8/26 (31%)
C2H2 Zn finger 78..100 CDD:275371 6/21 (29%)
ZnF_U1 238..263 CDD:197732 10/25 (40%)
C2H2 Zn finger 240..262 CDD:275371 10/21 (48%)
zf-C2H2_jaz 304..329 CDD:288983 8/24 (33%)
C2H2 Zn finger 306..328 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.