DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385a

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001128560.1 Gene:Zfp385a RGDID:1593784 Length:415 Species:Rattus norvegicus

Alignment Length:364 Identity:75/365 (21%)
Similarity:116/365 (32%) Gaps:142/365 (39%)


  Fly    57 GSIRTNMKRKAKCME-------------EDSLKANGDLAL------------------FP----- 85
            |.::|..|.:..|:.             |.||...|.|.|                  ||     
  Rat     4 GEVKTTPKGRPACVPRPTVDLLLEQQQGECSLSRAGPLPLLRQPPIMQPPMDLKQILPFPLEPAP 68

  Fly    86 --GRDESYP--EELNRLI------GPL--------NCQLCKVQMTSRKRARDHYESKAHDRHISA 132
              |...:|.  :.:.:.:      |||        :|.:|:::..|:.:|..||:...|.|.:. 
  Rat    69 TLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVK- 132

  Fly   133 WLAKNYTEVGLEA-------PPVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVE 190
                     |:||       |.|:......|.|.                               
  Rat   133 ---------GIEAAKTRGREPSVRESGDPAPAGS------------------------------- 157

  Fly   191 QGVAKPSGARHCDTSVG-RYGIGSLFRKPESLT-KDSPTDVLISENSVIK--------------- 238
               ..|||.......|. ..|:|.....||... ..||..|..|...|.|               
  Rat   158 ---TPPSGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSVPESGQGVTKGEGGTSVPASLPGGS 219

  Fly   239 SDDNERT-----CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEA------PIPETEKL 292
            .::.|:.     |.|||:.|.|.:|::||..|.:| |....:|......:|      |.|...:.
  Rat   220 KEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKH-KTILEARSGLGPIKAYPRLGPPTPGEPEA 283

  Fly   293 DAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKH 331
            .|.:    ||    ::|:.||:.:|.|..|:||...::|
  Rat   284 PAQD----RT----FHCEICNVKVNSEVQLKQHISSRRH 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/66 (23%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 0/23 (0%)
C2H2 Zn finger 164..186 CDD:275371 0/22 (0%)
UFD2 255..>338 CDD:227443 23/84 (27%)
ZnF_U1 304..336 CDD:197732 9/29 (31%)
Zfp385aNP_001128560.1 C2H2 Zn finger 105..127 CDD:275371 6/22 (27%)
zf-met 105..127 CDD:289631 6/22 (27%)
zf-met 231..254 CDD:289631 10/23 (43%)
C2H2 Zn finger 232..254 CDD:275371 10/22 (45%)
zf-met 291..314 CDD:289631 8/23 (35%)
C2H2 Zn finger 292..314 CDD:275371 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89410441
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.