DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and Zfp385a

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_038935827.1 Gene:Zfp385a / 685474 RGDID:1593784 Length:423 Species:Rattus norvegicus


Alignment Length:275 Identity:61/275 - (22%)
Similarity:93/275 - (33%) Gaps:96/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GPL--------NCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA-------PPVK 149
            |||        :|.:|:::..|:.:|..||:...|.|.:.          |:||       |.|:
  Rat   101 GPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVK----------GIEAAKTRGREPSVR 155

  Fly   150 RLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVG-RYGIGS 213
            ......|.|.                                  ..|||.......|. ..|:|.
  Rat   156 ESGDPAPAGS----------------------------------TPPSGDGVAPRPVSMENGLGP 186

  Fly   214 LFRKPESLT-KDSPTDVLISENSVIK---------------SDDNERT-----CHLCKIVVTSAA 257
            ....||... ..||..|..|...|.|               .::.|:.     |.|||:.|.|.:
  Rat   187 APGSPEKQPGSPSPPSVPESGQGVTKGEGGTSVPASLPGGSKEEEEKAKRLLYCALCKVAVNSLS 251

  Fly   258 QMQAHLAGARHQKNWRTSRQDQNHSEA------PIPETEKLDAAELALYRTPMGQYYCQPCNMMM 316
            |::||..|.:| |....:|......:|      |.|...:..|.:    ||    ::|:.||:.:
  Rat   252 QLEAHNKGTKH-KTILEARSGLGPIKAYPRLGPPTPGEPEAPAQD----RT----FHCEICNVKV 307

  Fly   317 NHESTLQQHFIGKKH 331
            |.|..|:||...::|
  Rat   308 NSEVQLKQHISSRRH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/65 (23%)
zf-met 104..126 CDD:289631 6/21 (29%)
zf-met 163..186 CDD:289631 0/22 (0%)
C2H2 Zn finger 164..186 CDD:275371 0/21 (0%)
UFD2 255..>338 CDD:227443 23/83 (28%)
ZnF_U1 304..336 CDD:197732 9/28 (32%)
Zfp385aXP_038935827.1 C2H2 Zn finger 113..135 CDD:275371 6/21 (29%)
zf-met 113..135 CDD:403930 6/21 (29%)
zf-met 238..262 CDD:403930 10/23 (43%)
C2H2 Zn finger 240..262 CDD:275371 10/21 (48%)
zf-met 298..322 CDD:403930 8/23 (35%)
C2H2 Zn finger 300..322 CDD:275371 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.