DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zmat4

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001128219.1 Gene:Zmat4 RGDID:1584398 Length:229 Species:Rattus norvegicus

Alignment Length:246 Identity:64/247 (26%)
Similarity:97/247 (39%) Gaps:45/247 (18%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFH----C 164
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|||..:..:..:...    |
  Rat    16 CKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGC---PAKRLRAENGSDADMVDKNKCC 77

  Fly   165 ELCNLDLTSSMHARQHYLGRKH-KRV-----EQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTK 223
            .|||:..||::.|..||.|:.| ||:     |:...|.:.|                  |.:..|
  Rat    78 TLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAA------------------PLTSLK 124

  Fly   224 DSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKN-WRTSRQDQNHSEAPIP 287
            ....|......|..:..|::|.|.||.....:....|.|..|.:|:|| .|.:..:|..:     
  Rat   125 APRVDTAPMVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGT----- 184

  Fly   288 ETEKLDAAEL-ALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKN 337
               .||..|| .|.||    |.|..|::.:|.......|..|.||...:||
  Rat   185 ---SLDLGELRGLRRT----YRCTTCSVSLNSIEQYHAHLQGSKHQTNLKN 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/59 (24%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 10/27 (37%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 25/86 (29%)
ZnF_U1 304..336 CDD:197732 8/32 (25%)
Zmat4NP_001128219.1 zf-met 15..38 CDD:289631 8/22 (36%)
C2H2 Zn finger 16..38 CDD:275371 8/22 (36%)
ZnF_U1 72..106 CDD:197732 13/34 (38%)
C2H2 Zn finger 77..99 CDD:275371 10/22 (45%)
ZnF_U1 142..176 CDD:197732 12/34 (35%)
C2H2 Zn finger 147..169 CDD:275371 6/22 (27%)
C2H2 Zn finger 200..222 CDD:275371 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.