DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zmat3

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_071993.1 Gene:Zmat3 RGDID:620134 Length:289 Species:Rattus norvegicus

Alignment Length:322 Identity:72/323 (22%)
Similarity:102/323 (32%) Gaps:136/323 (42%)


  Fly    76 KANGDLALFP----GRDESYP---EE-----------LNRLIGPLNCQLCKVQMTSRKRARDHYE 122
            ::.|.|.|.|    |::.|.|   ||           |..|..||.|:||.|.:.|.::|:.||:
  Rat    26 RSTGTLQLPPQKAFGQEASLPLAGEEDLAKRGEPDSALEELCKPLFCKLCNVTLNSAQQAQAHYQ 90

  Fly   123 SKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQG--------PTGPNAFHCELCNLDLTSSMHARQ 179
            .|.|.:.:..:.|.|      ..||..|::...        |..|....|               
  Rat    91 GKNHGKKLRNYYAAN------SCPPPARMSSVAEPVATPLVPVPPQVGSC--------------- 134

  Fly   180 HYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNER 244
                           ||.|                                    .||.:.:|: 
  Rat   135 ---------------KPGG------------------------------------RVILATEND- 147

  Fly   245 TCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHS-----EAPIPETEKLDA---------- 294
            .|.||....:|.|..|||..|..|.|..|.: :.|:||     ||....|.|..:          
  Rat   148 YCKLCDASFSSPAVAQAHYQGKNHAKRLRLA-EAQSHSFSDSAEAGQRRTRKEGSEFKMVTTRRN 211

  Fly   295 ---------------------AELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
                                 .:||:..||.||:||..||:....|...:||...|:|..:|
  Rat   212 MYTVQSNSGPYFNARSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEVEFRQHLESKQHKSKV 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/67 (25%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 1/23 (4%)
C2H2 Zn finger 164..186 CDD:275371 1/22 (5%)
UFD2 255..>338 CDD:227443 32/118 (27%)
ZnF_U1 304..336 CDD:197732 12/33 (36%)
Zmat3NP_071993.1 ZnF_U1 67..101 CDD:197732 12/34 (35%)
C2H2 Zn finger 72..94 CDD:275371 9/22 (41%)
ZnF_U1 144..177 CDD:197732 13/34 (38%)
C2H2 Zn finger 149..171 CDD:275371 9/22 (41%)
ZnF_U1 242..276 CDD:197732 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89561340
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46786
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.