DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and ZMAT3

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_071915.1 Gene:ZMAT3 HGNCID:29983 Length:289 Species:Homo sapiens

Alignment Length:306 Identity:71/307 (23%)
Similarity:112/307 (36%) Gaps:103/307 (34%)


  Fly    76 KANGDLALFP----GRDESYP----EELNR----------LIGPLNCQLCKVQMTSRKRARDHYE 122
            ::.|.|.|.|    |::.|.|    |||::          |..||.|:||.|.:.|.::|:.||:
Human    26 RSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQ 90

  Fly   123 SKAHDRHISAWLAKNYTEVGLEAPPVKRLA---------------KQGPTGPNA--------FHC 164
            .|.|.:.:..:.|.|      ..||..|::               :.|...|..        .:|
Human    91 GKNHGKKLRNYYAAN------SCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRVILATENDYC 149

  Fly   165 ELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTD 228
            :||:...:|...|:.||.|:.| ||:....|:.:.                              
Human   150 KLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNS------------------------------ 184

  Fly   229 VLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAG--ARHQKNWRTSRQDQNHSEAPI--PET 289
              .||:|.:                   .|.:|...|  .:...|.|.....||:|..|.  |.:
Human   185 --FSESSEL-------------------GQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPRS 228

  Fly   290 EKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
            .:....:||:..||.||:||..||:....|...:||...|:|..:|
Human   229 RQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKV 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/82 (21%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 8/23 (35%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 26/86 (30%)
ZnF_U1 304..336 CDD:197732 12/33 (36%)
ZMAT3NP_071915.1 ZnF_U1 67..101 CDD:197732 12/34 (35%)
C2H2 Zn finger 72..94 CDD:275371 9/22 (41%)
ZnF_U1 144..177 CDD:197732 11/33 (33%)
C2H2 Zn finger 149..171 CDD:275371 8/22 (36%)
ZnF_U1 243..277 CDD:197732 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89561278
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130269
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46786
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.